Drosophila melanogaster

UniProt Data

Accession A0A023GQ99 [ UniProt ]
Name A0A023GQ99_DROME
Description Uncharacterized protein, isoform C
Species Drosophila melanogaster
Sequence Length563

Enzyme Annotations (0)

    GO Annotations

    Cellular component (1)

    None predicted

    Molecular function (1)

    None predicted

    Biological process (1)

    None predicted

    Protein Sequence

    >A0A023GQ99
    MESEQPAAVKASAPIEEPQSTETAVELGKHSTLKADLSIDKLETATTATNAVVEPVEMEQQVENELVNESTQAMTSTTTQ
    EKVVGSVNNLVEEQQCVEMEFETSSDLVVQGSPSEESKKVASDASATVTAPQVQPAPHVDSSPQASGLSLLAAYSSDDSD
    DEKVTPVQNGDNDVIEVPVTDPASSTTAYRPVVAVSSDDESSKSSSSSSDSDSDSEGEYLTVLRKKIDKRINTVDCDEDD
    EDFDEDGATGDRSRRRQPPKVRGEMLLDDLPPIHQLEITVPEDECVELGKVQSIVDQLVLVSVLPNSMLFDLDTVLFLEK
    GRKVLGEVFDVLGQVSDPLYCVRFNSNKQILDRGIKIGDVVYCAPKTEHTQFVILSKLMQVRGSDASWEHDVEPPARYVD
    HSDDEEEREARAEQRKRRQRDRTNSTDSVDTVTSVATTATKASSVAPPPRQRGRRGQRESFRQSQRPSINQHNQNQPQDE
    QYNFHPSYNPGSWHSNYYQNYHQAAANFNMAQQHPGMPFPVPNYGYGMPYAMPPMYPHMYPPPPPFAPPPPNNQSHQGQP
    PPS