Saccharomyces cerevisiae S288C

UniProt Data

Accession A0A023PZB3 [ UniProt ]
Name FMP49_YEAST
Description Protein FMP49, mitochondrial
Species Saccharomyces cerevisiae S288C
Sequence Length126

Enzyme Annotations (0)

    GO Annotations

    Cellular component (1)

    None predicted

    Molecular function (1)

    None predicted

    Biological process (1)

    None predicted

    Protein Sequence

    >A0A023PZB3
    MYYFSRVAARTFCCCIFFCLATAYSRPDRNPRKIEKKDKKFFGASKNTNPANAMGNLFKAPTIEYVVEEVTRTHQPEQYD
    IPTDMSPLMTIAASESADKFTDKFFVDQSSIMKEKTSSKGNARTLL