Saccharomyces cerevisiae S288C

UniProt Data

Accession O13549 [ UniProt ]
Name VPS63_YEAST
Description Uncharacterized protein VPS63
Species Saccharomyces cerevisiae S288C
Sequence Length108

Enzyme Annotations (0)

    GO Annotations

    Cellular component (1)

    None predicted

    Molecular function (1)

    None predicted

    Biological process (1)

    None predicted

    Protein Sequence

    >O13549
    MKEVTKMLYCALLVTKVIYQMKGKSQPKRERKKQNYWVLKSLWKRPQRQAIMSKLYSKRLPNRCLNFKTASQLLWIAKMQ
    IVQTKINRESLIFLQQRSRNKALVSVST