Saccharomyces cerevisiae S288C

UniProt Data

Accession O13556 [ UniProt ]
Name YL462_YEAST
Description Putative uncharacterized protein YLR462W
Species Saccharomyces cerevisiae S288C
Sequence Length202

Enzyme Annotations (0)

    GO Annotations

    Cellular component (1)

    None predicted

    Molecular function (1)

    None predicted

    Biological process (1)

    None predicted

    Protein Sequence

    >O13556
    MKVSDRRKFEKANFDEFESALNNKNDLVHCPSITLFESIPTEVRSFYEDEKSGLIKVVKFRTGAMDRKRSFEKVVISVMV
    GKNVKKFLTFVEDEPDFQGGPIPSKYLVPKKINLMVYTLFQVHTLKFNRKDYDTLSLFYLNRGYYNELSFRVLERCHEIA
    SARPNDSSTMRTFTDFVSGAPIVRSLQKSTIRKYGYNLAAYT