Saccharomyces cerevisiae S288C

UniProt Data

Accession O13574 [ UniProt ]
Name YL255_YEAST
Description Putative uncharacterized protein YLR255C
Species Saccharomyces cerevisiae S288C
Sequence Length117

Enzyme Annotations (0)

    GO Annotations

    Cellular component (1)

    None predicted

    Molecular function (1)

    None predicted

    Biological process (1)

    None predicted

    Protein Sequence

    >O13574
    MGVGGTRIVSFRQPNYYPVTQQKGASQTGAVAQPYSSYCGLLMRWAVVEIRRRGKGKGRKRKREREKGHTKFRIRRRSYL
    YFIRSCLVRPYSSGNKKNSCSFHKMLAIEIVLCLKAR