Saccharomyces cerevisiae S288C

UniProt Data

Accession O14455 [ UniProt ]
Name RL36B_YEAST
Description 60S ribosomal protein L36-B
Species Saccharomyces cerevisiae S288C
Sequence Length100

Enzyme Annotations (0)

    GO Annotations

    Cellular component (1)

    None predicted

    Molecular function (3)

    • GO:0003723 RNA binding
      Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    • GO:0003735 Structural constituent of ribosome
      The action of a molecule that contributes to the structural integrity of the ribosome.
    • GO:0005515 Protein binding
      Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).

    Biological process (1)

    None predicted

    Protein Sequence

    >O14455
    MAVKTGIAIGLNKGKKVTQMTPAPKISYKKGAASNRTKFVRSLVREIAGLSPYERRLIDLIRNSGEKRARKVAKKRLGSF
    TRAKAKVEEMNNIIAASRRH