Abl1 Tyrosine-protein kinase ABL1

• Overview
• Annotations

UniProt Data

Enzyme Annotations (1)

• EC:2.7.10.2 Non-specific protein-tyrosine kinase.
  ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.

GO Annotations

Cellular component (17)

• GO:0005634 Nucleus
  A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
• GO:0005634 Nucleus
  A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
• GO:0005654 Nucleoplasm
  That part of the nuclear content other than the chromosomes or the nucleolus.
• GO:0005730 Nucleolus
  A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
• GO:0005737 Cytoplasm
  All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
• GO:0005737 Cytoplasm
  All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
• GO:0005829 Cytosol
  The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
• GO:0005829 Cytosol
  The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
• GO:0005829 Cytosol
  The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
• GO:0015629 Actin cytoskeleton
  The part of the cytoskeleton (the internal framework of a cell) composed of actin and associated proteins. Includes actin cytoskeleton-associated complexes.
• GO:0016604 Nuclear body
  Extra-nucleolar nuclear domains usually visualized by confocal microscopy and fluorescent antibodies to specific proteins.
• GO:0030425 Dendrite
  A neuron projection that has a short, tapering, often branched, morphology, receives and integrates signals from other neurons or from sensory stimuli, and conducts a nerve impulse towards the axon or the cell body. In most neurons, the impulse is conveyed from dendrites to axon via the cell body, but in some types of unipolar neuron, the impulse does not travel via the cell body.
• GO:0031252 Cell leading edge
  The area of a motile cell closest to the direction of movement.
• GO:0043005 Neuron projection
  A prolongation or process extending from a nerve cell, e.g. an axon or dendrite.
• GO:0043025 Neuronal cell body
  The portion of a neuron that includes the nucleus, but excludes cell projections such as axons and dendrites.
• GO:0043234 Protein complex
  A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.
• GO:0048471 Perinuclear region of cytoplasm
  Cytoplasm situated near, or occurring around, the nucleus.

Molecular function (27)

• GO:0000287 Magnesium ion binding
  Interacting selectively and non-covalently with magnesium (Mg) ions.
• GO:0000287 Magnesium ion binding
  Interacting selectively and non-covalently with magnesium (Mg) ions.
• GO:0001784 Phosphotyrosine binding
  Interacting selectively and non-covalently with a phosphorylated tyrosine residue within a protein.
• GO:0004672 Protein kinase activity
  Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
• GO:0004672 Protein kinase activity
  Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
• GO:0004713 Protein tyrosine kinase activity
  Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
• GO:0004713 Protein tyrosine kinase activity
  Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
• GO:0004713 Protein tyrosine kinase activity
  Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
• GO:0004713 Protein tyrosine kinase activity
  Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
• GO:0004715 Non-membrane spanning protein tyrosine kinase activity
  Catalysis of the reaction: ATP + protein L-tyrosine = ADP + protein L-tyrosine phosphate by a non-membrane spanning protein.
• GO:0005080 Protein kinase C binding
  Interacting selectively and non-covalently with protein kinase C.
• GO:0005515 Protein binding
  Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
• GO:0005524 ATP binding
  Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
• GO:0005524 ATP binding
  Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
• GO:0008022 Protein C-terminus binding
  Interacting selectively and non-covalently with a protein C-terminus, the end of any peptide chain at which the 1-carboxy function of a constituent amino acid is not attached in peptide linkage to another amino-acid residue.
• GO:0016301 Kinase activity
  Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
• GO:0017124 SH3 domain binding
  Interacting selectively and non-covalently with a SH3 domain (Src homology 3) of a protein, small protein modules containing approximately 50 amino acid residues found in a great variety of intracellular or membrane-associated proteins.
• GO:0019904 Protein domain specific binding
  Interacting selectively and non-covalently with a specific domain of a protein.
• GO:0019905 Syntaxin binding
  Interacting selectively and non-covalently with a syntaxin, a SNAP receptor involved in the docking of synaptic vesicles at the presynaptic zone of a synapse.
• GO:0030145 Manganese ion binding
  Interacting selectively and non-covalently with manganese (Mn) ions.
• GO:0030145 Manganese ion binding
  Interacting selectively and non-covalently with manganese (Mn) ions.
• GO:0042169 SH2 domain binding
  Interacting selectively and non-covalently with a SH2 domain (Src homology 2) of a protein, a protein domain of about 100 amino-acid residues and belonging to the alpha + beta domain class.
• GO:0046875 Ephrin receptor binding
  Interacting selectively and non-covalently with an ephrin receptor.
• GO:0051015 Actin filament binding
  Interacting selectively and non-covalently with an actin filament, also known as F-actin, a helical filamentous polymer of globular G-actin subunits.
• GO:0051019 Mitogen-activated protein kinase binding
  Interacting selectively and non-covalently with a mitogen-activated protein kinase.
• GO:0070064 Proline-rich region binding
  Interacting selectively and non-covalently with a proline-rich region, i.e. a region that contains a high proportion of proline residues, in a protein.
• GO:0070064 Proline-rich region binding
  Interacting selectively and non-covalently with a proline-rich region, i.e. a region that contains a high proportion of proline residues, in a protein.

Biological process (85)

• GO:0001843 Neural tube closure
  The last step in the formation of the neural tube, where the paired neural folds are brought together and fuse at the dorsal midline.
• GO:0001922 B-1 B cell homeostasis
  The process of regulating the proliferation and elimination of B cells of the B-1 subset such that the total number of B-1 B cells within a whole or part of an organism is stable over time in the absence of an outside stimulus. B-1 B cells are a distinct subset of B cells characterized as being CD5 positive, found predominantly in the peritoneum, pleural cavities, and spleen, and enriched for self-reactivity.
• GO:0001934 Positive regulation of protein phosphorylation
  Any process that activates or increases the frequency, rate or extent of addition of phosphate groups to amino acids within a protein.
• GO:0002322 B cell proliferation involved in immune response
  The expansion of a B cell population by cell division following B cell activation during an immune response.
• GO:0002322 B cell proliferation involved in immune response
  The expansion of a B cell population by cell division following B cell activation during an immune response.
• GO:0002333 Transitional one stage B cell differentiation
  The process in which immature B cells from the bone marrow acquire the specialized features of T1 stage B cells in the spleen. T1 stage B cells do not express either CD23 or CD21.
• GO:0006909 Phagocytosis
  An endocytosis process that results in the engulfment of external particulate material by phagocytes. The particles are initially contained within phagocytic vacuoles (phagosomes), which then fuse with primary lysosomes to effect digestion of the particles.
• GO:0006909 Phagocytosis
  An endocytosis process that results in the engulfment of external particulate material by phagocytes. The particles are initially contained within phagocytic vacuoles (phagosomes), which then fuse with primary lysosomes to effect digestion of the particles.
• GO:0006974 Cellular response to DNA damage stimulus
  Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
• GO:0006974 Cellular response to DNA damage stimulus
  Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
• GO:0006975 DNA damage induced protein phosphorylation
  The widespread phosphorylation of various molecules, triggering many downstream processes, that occurs in response to the detection of DNA damage.
• GO:0006979 Response to oxidative stress
  Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of oxidative stress, a state often resulting from exposure to high levels of reactive oxygen species, e.g. superoxide anions, hydrogen peroxide (H2O2), and hydroxyl radicals.
• GO:0006979 Response to oxidative stress
  Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of oxidative stress, a state often resulting from exposure to high levels of reactive oxygen species, e.g. superoxide anions, hydrogen peroxide (H2O2), and hydroxyl radicals.
• GO:0007173 Epidermal growth factor receptor signaling pathway
  A series of molecular signals initiated by binding of a ligand to the tyrosine kinase receptor EGFR (ERBB1) on the surface of a cell. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
• GO:0007204 Positive regulation of cytosolic calcium ion concentration
  Any process that increases the concentration of calcium ions in the cytosol.
• GO:0007596 Blood coagulation
  The sequential process in which the multiple coagulation factors of the blood interact, ultimately resulting in the formation of an insoluble fibrin clot; it may be divided into three stages: stage 1, the formation of intrinsic and extrinsic prothrombin converting principle; stage 2, the formation of thrombin; stage 3, the formation of stable fibrin polymers.
• GO:0009791 Post-embryonic development
  The process whose specific outcome is the progression of the organism over time, from the completion of embryonic development to the mature structure. See embryonic development.
• GO:0018108 Peptidyl-tyrosine phosphorylation
  The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine.
• GO:0018108 Peptidyl-tyrosine phosphorylation
  The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine.
• GO:0021587 Cerebellum morphogenesis
  The process in which the anatomical structure of the cerebellum is generated and organized. The cerebellum is the portion of the brain in the back of the head between the cerebrum and the pons. The cerebellum controls balance for walking and standing, modulates the force and range of movement and is involved in the learning of motor skills.
• GO:0022408 Negative regulation of cell-cell adhesion
  Any process that stops, prevents or reduces the rate or extent of cell adhesion to another cell.
• GO:0030035 Microspike assembly
  Formation of a microspike, a dynamic, actin-rich projection extending from the surface of a migrating animal cell.
• GO:0030036 Actin cytoskeleton organization
  A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising actin filaments and their associated proteins.
• GO:0030036 Actin cytoskeleton organization
  A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising actin filaments and their associated proteins.
• GO:0030182 Neuron differentiation
  The process in which a relatively unspecialized cell acquires specialized features of a neuron.
• GO:0030514 Negative regulation of BMP signaling pathway
  Any process that stops, prevents, or reduces the frequency, rate or extent of the BMP signaling pathway.
• GO:0030516 Regulation of axon extension
  Any process that modulates the rate, direction or extent of axon extension.
• GO:0031113 Regulation of microtubule polymerization
  Any process that modulates the frequency, rate or extent of microtubule polymerization.
• GO:0032956 Regulation of actin cytoskeleton organization
  Any process that modulates the frequency, rate or extent of the formation, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising actin filaments and their associated proteins.
• GO:0032956 Regulation of actin cytoskeleton organization
  Any process that modulates the frequency, rate or extent of the formation, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising actin filaments and their associated proteins.
• GO:0033690 Positive regulation of osteoblast proliferation
  Any process that activates or increases the rate or extent of osteoblast proliferation.
• GO:0034446 Substrate adhesion-dependent cell spreading
  The morphogenetic process that results in flattening of a cell as a consequence of its adhesion to a substrate.
• GO:0035791 Platelet-derived growth factor receptor-beta signaling pathway
  A series of molecular signals initiated by the binding of a ligand to a beta-type platelet-derived growth factor receptor (PDGFbeta) on the surface of a signal-receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription.
• GO:0038083 Peptidyl-tyrosine autophosphorylation
  The phosphorylation by a protein of one or more of its own tyrosine amino acid residues, or a tyrosine residue on an identical protein.
• GO:0042100 B cell proliferation
  The expansion of a B cell population by cell division. Follows B cell activation.
• GO:0042127 Regulation of cell proliferation
  Any process that modulates the frequency, rate or extent of cell proliferation.
• GO:0042770 Signal transduction in response to DNA damage
  A cascade of processes induced by the detection of DNA damage within a cell.
• GO:0042770 Signal transduction in response to DNA damage
  A cascade of processes induced by the detection of DNA damage within a cell.
• GO:0043065 Positive regulation of apoptotic process
  Any process that activates or increases the frequency, rate or extent of cell death by apoptotic process.
• GO:0043065 Positive regulation of apoptotic process
  Any process that activates or increases the frequency, rate or extent of cell death by apoptotic process.
• GO:0043123 Positive regulation of I-kappaB kinase/NF-kappaB signaling
  Any process that activates or increases the frequency, rate or extent of I-kappaB kinase/NF-kappaB signaling.
• GO:0043124 Negative regulation of I-kappaB kinase/NF-kappaB signaling
  Any process that stops, prevents, or reduces the frequency, rate or extent of -kappaB kinase/NF-kappaB signaling.
• GO:0045184 Establishment of protein localization
  The directed movement of a protein to a specific location.
• GO:0045930 Negative regulation of mitotic cell cycle
  Any process that stops, prevents or reduces the rate or extent of progression through the mitotic cell cycle.
• GO:0045930 Negative regulation of mitotic cell cycle
  Any process that stops, prevents or reduces the rate or extent of progression through the mitotic cell cycle.
• GO:0045931 Positive regulation of mitotic cell cycle
  Any process that activates or increases the rate or extent of progression through the mitotic cell cycle.
• GO:0046632 Alpha-beta T cell differentiation
  The process in which a precursor cell type acquires the specialized features of an alpha-beta T cell. An alpha-beta T cell is a T cell that expresses an alpha-beta T cell receptor complex.
• GO:0046777 Protein autophosphorylation
  The phosphorylation by a protein of one or more of its own amino acid residues (cis-autophosphorylation), or residues on an identical protein (trans-autophosphorylation).
• GO:0048008 Platelet-derived growth factor receptor signaling pathway
  The series of molecular signals generated as a consequence of a platelet-derived growth factor receptor binding to one of its physiological ligands.
• GO:0048008 Platelet-derived growth factor receptor signaling pathway
  The series of molecular signals generated as a consequence of a platelet-derived growth factor receptor binding to one of its physiological ligands.
• GO:0048536 Spleen development
  The process whose specific outcome is the progression of the spleen over time, from its formation to the mature structure. The spleen is a large vascular lymphatic organ composed of white and red pulp, involved both in hemopoietic and immune system functions.
• GO:0048538 Thymus development
  The process whose specific outcome is the progression of the thymus over time, from its formation to the mature structure. The thymus is a symmetric bi-lobed organ involved primarily in the differentiation of immature to mature T cells, with unique vascular, nervous, epithelial, and lymphoid cell components.
• GO:0048668 Collateral sprouting
  The process in which outgrowths develop from the shafts of existing axons.
• GO:0050731 Positive regulation of peptidyl-tyrosine phosphorylation
  Any process that activates or increases the frequency, rate or extent of the phosphorylation of peptidyl-tyrosine.
• GO:0050731 Positive regulation of peptidyl-tyrosine phosphorylation
  Any process that activates or increases the frequency, rate or extent of the phosphorylation of peptidyl-tyrosine.
• GO:0050798 Activated T cell proliferation
  The expansion of a T cell population following activation by an antigenic stimulus.
• GO:0050853 B cell receptor signaling pathway
  A series of molecular signals initiated by the cross-linking of an antigen receptor on a B cell.
• GO:0050885 Neuromuscular process controlling balance
  Any process that an organism uses to control its balance, the orientation of the organism (or the head of the organism) in relation to the source of gravity. In humans and animals, balance is perceived through visual cues, the labyrinth system of the inner ears and information from skin pressure receptors and muscle and joint receptors.
• GO:0051149 Positive regulation of muscle cell differentiation
  Any process that activates or increases the frequency, rate or extent of muscle cell differentiation.
• GO:0051281 Positive regulation of release of sequestered calcium ion into cytosol
  Any process that activates or increases the frequency, rate or extent of the release into the cytosolic compartment of calcium ions sequestered in the endoplasmic reticulum or mitochondria.
• GO:0051353 Positive regulation of oxidoreductase activity
  Any process that activates or increases the frequency, rate or extent of oxidoreductase activity, the catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered.
• GO:0051444 Negative regulation of ubiquitin-protein transferase activity
  Any process that stops, prevents, or reduces the frequency, rate or extent of ubiquitin transferase activity.
• GO:0051726 Regulation of cell cycle
  Any process that modulates the rate or extent of progression through the cell cycle.
• GO:0060020 Bergmann glial cell differentiation
  The process in which neuroepithelial cells of the neural tube give rise to Brgmann glial cells, specialized bipotential progenitors cells of the cerebellum. Differentiation includes the processes involved in commitment of a cell to a specific fate.
• GO:0060563 Neuroepithelial cell differentiation
  The process in which epiblast cells acquire specialized features of neuroepithelial cells.
• GO:0070301 Cellular response to hydrogen peroxide
  Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a hydrogen peroxide (H2O2) stimulus.
• GO:0070373 Negative regulation of ERK1 and ERK2 cascade
  Any process that stops, prevents, or reduces the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
• GO:0070374 Positive regulation of ERK1 and ERK2 cascade
  Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
• GO:0071222 Cellular response to lipopolysaccharide
  Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lipopolysaccharide stimulus; lipopolysaccharide is a major component of the cell wall of gram-negative bacteria.
• GO:0071901 Negative regulation of protein serine/threonine kinase activity
  Any process that decreases the rate, frequency, or extent of protein serine/threonine kinase activity.
• GO:0072358 Cardiovascular system development
  The process whose specific outcome is the progression of the cardiovascular system over time, from its formation to the mature structure. The cardiovascular system is the anatomical system that has as its parts the heart and blood vessels.
• GO:0090135 Actin filament branching
  The formation of daughter actin filament branches at an angle on the sides of preexisting mother filaments.
• GO:1900042 Positive regulation of interleukin-2 secretion
  Any process that activates or increases the frequency, rate or extent of interleukin-2 secretion.
• GO:1900275 Negative regulation of phospholipase C activity
  Any process that stops, prevents or reduces the frequency, rate or extent of phospholipase C activity.
• GO:1901216 Positive regulation of neuron death
  Any process that activates or increases the frequency, rate or extent of neuron death.
• GO:1902715 Positive regulation of interferon-gamma secretion
  Any process that activates or increases the frequency, rate or extent of interferon-gamma secretion.
• GO:1903053 Regulation of extracellular matrix organization
  Any process that modulates the frequency, rate or extent of extracellular matrix organization.
• GO:1904528 Positive regulation of microtubule binding
  Any process that activates or increases the frequency, rate or extent of microtubule binding.
• GO:1904531 Positive regulation of actin filament binding
  Any process that activates or increases the frequency, rate or extent of actin filament binding.
• GO:1990051 Activation of protein kinase C activity
  Any process that initiates the activity of the inactive enzyme protein kinase C.
• GO:2000096 Positive regulation of Wnt signaling pathway, planar cell polarity pathway
  Any process that activates or increases the frequency, rate or extent of Wnt signaling pathway, planar cell polarity pathway.
• GO:2000352 Negative regulation of endothelial cell apoptotic process
  Any process that stops, prevents or reduces the frequency, rate or extent of endothelial cell apoptotic process.
• GO:2000772 Regulation of cellular senescence
  Any process that modulates the frequency, rate or extent of cellular senescence.
• GO:2000773 Negative regulation of cellular senescence
  Any process that stops, prevents or reduces the frequency, rate or extent of cellular senescence.
• GO:2001020 Regulation of response to DNA damage stimulus
  Any process that modulates the frequency, rate or extent of response to DNA damage stimulus.

Protein Sequence

>P00520
MLEICLKLVGCKSKKGLSSSSSCYLEEALQRPVASDFEPQGLSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTL
SITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQ
RSISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTIYGVSPNYDKWEMERT
DITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTY
GNLLDYLRECNRQEVSAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAK
FPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNP
SDRPSFAEIHQAFETMFQESSISDEVEKELGKRGTRGGAGSMLQAPELPTKTRTCRRAAEQKDAPDTPELLHTKGLGESD
ALDSEPAVSPLLPRKERGPPDGSLNEDERLLPRDRKTNLFSALIKKKKKMAPTPPKRSSSFREMDGQPDRRGASEDDSRE
LCNGPPALTSDAAEPTKSPKASNGAGVPNGAFREPGNSGFRSPHMWKKSSTLTGSRLAAAEEESGMSSSKRFLRSCSASC
MPHGARDTEWRSVTLPRDLPSAGKQFDSSTFGGHKSEKPALPRKRTSESRSEQVAKSTAMPPPRLVKKNEEAAEEGFKDT
ESSPGSSPPSLTPKLLRRQVTASPSSGLSHKEEATKGSASGMGTPATAEPAPPSNKVGLSKASSEEMRVRRHKHSSESPG
RDKGRLAKLKPAPPPPPACTGKAGKPAQSPSQEAGEAGGPTKTKCTSLAMDAVNTDPTKAGPPGEGLRKPVPPSVPKPQS
TAKPPGTPTSPVSTPSTAPAPSPLAGDQQPSSAAFIPLISTRVSLRKTRQPPERIASGTITKGVVLDSTEALCLAISRNS
EQMASHSAVLEAGKNLYTFCVSYVDSIQQMRNKFAFREAINKLESNLRELQICPATASSGPAATQDFSKLLSSVKEISDI
VRR