IGKV2-28 Immunoglobulin kappa variable 2-28
UniProt Data
Accession | A0A075B6P5 [ UniProt ] |
Name | KV228_HUMAN |
Description | Immunoglobulin kappa variable 2-28 |
Species | Homo sapiens |
Sequence Length | 120 |
Enzyme Annotations (0)
GO Annotations
Cellular component (2)
- GO:0005576 Extracellular region
The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite. - GO:0005886 Plasma membrane
The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
Molecular function (1)
None predictedBiological process (8)
- GO:0006898 Receptor-mediated endocytosis
An endocytosis process in which cell surface receptors ensure specificity of transport. A specific receptor on the cell surface binds tightly to the extracellular macromolecule (the ligand) that it recognizes; the plasma-membrane region containing the receptor-ligand complex then undergoes endocytosis, forming a transport vesicle containing the receptor-ligand complex and excluding most other plasma-membrane proteins. Receptor-mediated endocytosis generally occurs via clathrin-coated pits and vesicles. - GO:0006956 Complement activation
Any process involved in the activation of any of the steps of the complement cascade, which allows for the direct killing of microbes, the disposal of immune complexes, and the regulation of other immune processes; the initial steps of complement activation involve one of three pathways, the classical pathway, the alternative pathway, and the lectin pathway, all of which lead to the terminal complement pathway. - GO:0006958 Complement activation, classical pathway
Any process involved in the activation of any of the steps of the classical pathway of the complement cascade which allows for the direct killing of microbes, the disposal of immune complexes, and the regulation of other immune processes. - GO:0030449 Regulation of complement activation
Any process that modulates the frequency, rate or extent of complement activation. - GO:0038095 Fc-epsilon receptor signaling pathway
A series of molecular signals initiated by the binding of the Fc portion of immunoglobulin E (IgE) to an Fc-epsilon receptor on the surface of a signal-receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription. The Fc portion of an immunoglobulin is its C-terminal constant region. - GO:0038096 Fc-gamma receptor signaling pathway involved in phagocytosis
An Fc-gamma receptor signaling pathway that contributes to the endocytic engulfment of external particulate material by phagocytes. - GO:0050776 Regulation of immune response
Any process that modulates the frequency, rate or extent of the immune response, the immunological reaction of an organism to an immunogenic stimulus. - GO:0050900 Leukocyte migration
The movement of a leukocyte within or between different tissues and organs of the body.
Protein Sequence
>A0A075B6P5 MRLPAQLLGLLMLWVSGSSGDIVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLDWYLQKPGQSPQLLIYLGSNRA SGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTP