Lpin Lipin, isoform G

• Overview
• Annotations

UniProt Data

Enzyme Annotations (1)

• EC:3.1.3.4 Phosphatidate phosphatase.
  A 1,2-diacylglycerol 3-phosphate + H(2)O = a 1,2-diacyl-sn-glycerol + phosphate.

GO Annotations

Cellular component (3)

• GO:0005634 Nucleus
  A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
• GO:0005737 Cytoplasm
  All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
• GO:0035183 Female germline ring canal inner rim
  A proteinaceous actin-rich layer of the insect ovarian ring canal that forms subcortically to the outer rim. The electron dense inner rim accumulates after the final mitotic division of each germline syncytia, and contains actin, a phosphotyrosine protein, and a number of cytoskeletal proteins.

Molecular function (2)

• GO:0003713 Transcription coactivator activity
  Interacting selectively and non-covalently with a activating transcription factor and also with the basal transcription machinery in order to increase the frequency, rate or extent of transcription. Cofactors generally do not bind the template nucleic acid, but rather mediate protein-protein interactions between activating transcription factors and the basal transcription machinery.
• GO:0008195 Phosphatidate phosphatase activity
  Catalysis of the reaction: a 1,2-diacylglycerol 3-phosphate + H2O = a 1,2-diacyl-sn-glycerol + phosphate.

Biological process (9)

• GO:0006357 Regulation of transcription from RNA polymerase II promoter
  Any process that modulates the frequency, rate or extent of transcription from an RNA polymerase II promoter.
• GO:0007474 Imaginal disc-derived wing vein specification
  The regionalization process in which the area of a imaginal disc-derived wing that will form a wing vein is specified.
• GO:0010565 Regulation of cellular ketone metabolic process
  Any process that modulates the chemical reactions and pathways involving any of a class of organic compounds that contain the carbonyl group, CO, and in which the carbonyl group is bonded only to carbon atoms. The general formula for a ketone is RCOR, where R and R are alkyl or aryl groups.
• GO:0019217 Regulation of fatty acid metabolic process
  Any process that modulates the frequency, rate or extent of the chemical reactions and pathways involving fatty acids.
• GO:0019432 Triglyceride biosynthetic process
  The chemical reactions and pathways resulting in the formation of a triglyceride, any triester of glycerol.
• GO:0030514 Negative regulation of BMP signaling pathway
  Any process that stops, prevents, or reduces the frequency, rate or extent of the BMP signaling pathway.
• GO:0030514 Negative regulation of BMP signaling pathway
  Any process that stops, prevents, or reduces the frequency, rate or extent of the BMP signaling pathway.
• GO:0042594 Response to starvation
  Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a starvation stimulus, deprivation of nourishment.
• GO:0055088 Lipid homeostasis
  Any process involved in the maintenance of an internal steady state of lipid within an organism or cell.

Protein Sequence

>A0A0B4JCS1
MKLGDSGEAFFVEECLEDEDEELPANLATSPIPNSFLASRDKANDTMEDISGVVTDKNASEELLLPLPLPRRNSIDFSKE
EPKEAVVEGSKFENQVSDYTQRRHTDNTLERRNLSEKLKEFTTQKIRQEWAEHEELFQGEKKPADSDSLDNQSKASNEAE
TEKAIPAVIEDTEKEKDQIKPDVNLTTVTTSEATKEVSKSKTKKRRKKSQMKKNAQRKNSSSSSLGSAGGGDLPSAETPS
LGVSNIDEGDAPISSATNNNNTSSSNDEQLSAPLVTARTGDDSPLSEIPHTPTSNPRLDLDIHFFSDTEITTPVGGGGAG
SGRAAGGRPSTPIQSDSELETTMRDNRHVVTEESTASWKWGELPTPEQAKNEAMSAAQVQQSEHQSMLSNMFSFMKRANR
LRKEKGVGEVGDIYLSDLDAGSMDPEMAALYFPSPLSKAASPPEEDGESGNGTSLPHSPSSLEEGQKSIDSDFDETKQQR
DNNRYLDFVAMSMCGMSEQGAPPSDEEFDRHLVNYPDVCKSPSIFSSPNLVVRLNGKYYTWMAACPIVMTMITFQKPLTH
DAIEQLMSQTVDGKCLPGDEKQEAVAQADNGGQTKRYWWSWRRSQDAAPNHLNNTHGMPLGKDEKDGDQAAVATQTSRPT
SPDITDPTLSKSDSLVNAENTSALVDNLEELTMASNKSDEPKERYKKSLRLSSAAIKKLNLKEGMNEIEFSVTTAYQGTT
RCKCYLFRWKHNDKVVISDIDGTITKSDVLGHILPMVGKDWAQLGVAQLFSKIEQNGYKLLYLSARAIGQSRVTREYLRS
IRQGNVMLPDGPLLLNPTSLISAFHREVIEKKPEQFKIACLSDIRDLFPDKEPFYAGYGNRINDVWAYRAVGIPIMRIFT
INTKGELKHELTQTFQSSGYINQSLEVDEYFPLLTNQDEFDYRTDIFDDEESEEELQFSDDYDVDVEHGSSEESSGDEDD
DEALYNDDFANDDNGIQAVVASGDERTADVGLIMRVRRVSTKNEVIMASPPKWINS