fest CG9975, isoform B
UniProt Data
Accession | A0A0B4JCT9 [ UniProt ] |
Name | A0A0B4JCT9_DROME |
Description | CG9975, isoform B |
Species | Drosophila melanogaster |
Sequence Length | 511 |
Enzyme Annotations (0)
GO Annotations
Cellular component (2)
- GO:0005615 Extracellular space
That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid. - GO:0005737 Cytoplasm
All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
Molecular function (1)
None predictedBiological process (2)
- GO:0007054 Spindle assembly involved in male meiosis I
The formation of the spindle during meiosis I of a meiotic cell cycle in males. An example of this is found in Drosophila melanogaster. - GO:0032504 Multicellular organism reproduction
The biological process in which new individuals are produced by one or two multicellular organisms. The new individuals inherit some proportion of their genetic material from the parent or parents.
Protein Sequence
>A0A0B4JCT9 MVTDAQDTVAPKTSSTKEVQCQHSGALDEPHVEELALPGPAPLATPKSGRVGIFNAEDFLSRAQLNDKINNILRSPTKAP NGVRQRSVFTNNNPSPQATMRFVSSMNSPLAPRMSSLSLTGGVKRGLERGNSSSSMGNSASVGTSTSVLAKECSSQTNSC GRSYMNMGMHASSHSGFGVLPQSGAGYETMGWNMDAGNITRSGKSLTGRFNSGYGYEVDGAYCMAHHTQQFPSPMPPPPF AMDRVSSRTFEFENNTPPPCPGSGPIAMSNGTIQLRLREGVRIDMTLDKAVRVLNQRSMVAAALSRNCSNSALIHPNGRI LQSGSKVEIVTYDGMKANNFVRYAKMWYKGVSFTSESCALIYLVDTAGTRTTTDTFTDLTKDYTLAVFYDDSRHGPSFVS DAHDVIANSTYNCAEDGTEVYDINGFRITQAADGLVKVSRQHSKCLIRTSPGNGSATLTTTGIHCTASLGKTSHLFVRRN EKRMHFDGSCFIVRNAGHSAGFNENNLLIVY