Genome3D
Schizosaccharomyces pombe 972h-

gon7 EKC/KEOPS complex subunit gon7

UniProt Data

Accession A6X972 [ UniProt ]
Name GON7_SCHPO
Description EKC/KEOPS complex subunit gon7
Species Schizosaccharomyces pombe 972h-
Sequence Length73

Enzyme Annotations (0)

    GO Annotations

    Cellular component (2)

    • GO:0000408 EKC/KEOPS complex
      A protein complex involved in t6A tRNA modification; originally proposed to be involved in transcription as well as promoting telomere uncapping and telomere elongation. For example, in Saccharomyces cerevisiae the complex contains Bud32p, Kae1p, Gon7p, Cgi121p, and Pcc1p.
    • GO:0000784 Nuclear chromosome, telomeric region
      The terminal region of a linear nuclear chromosome that includes the telomeric DNA repeats and associated proteins.

    Molecular function (1)

    None predicted

    Biological process (1)

    None predicted

    Protein Sequence

    >A6X972
MNNLELTYKCETDTTRPFLKSLPVGFEPVEVDDYYISLKEQVRAMQDHCNEEFTKKMQTEGKNDVPEEKPIIL