B5BP47 Uncharacterized transporter C460.03
UniProt Data
Accession | B5BP47 [ UniProt ] |
Name | YP53_SCHPO |
Description | Uncharacterized transporter C460.03 |
Species | Schizosaccharomyces pombe 972h- |
Sequence Length | 567 |
Enzyme Annotations (0)
GO Annotations
Cellular component (2)
- GO:0000329 Fungal-type vacuole membrane
The lipid bilayer surrounding a vacuole, the shape of which correlates with cell cycle phase. The membrane separates its contents from the cytoplasm of the cell. An example of this structure is found in Saccharomyces cerevisiae. - GO:0031166 Integral component of vacuolar membrane
The component of the vacuolar membrane consisting of gene products and protein complexes that have some part that penetrates at least one leaflet of the membrane bilayer. May also refer to the state of being buried in the bilayer with no exposure outside the bilayer.
Molecular function (1)
None predictedBiological process (5)
- GO:0089709 L-histidine transmembrane transport
The directed movement of L-histidine across a membrane. - GO:1903400 L-arginine transmembrane transport
The directed movement of L-arginine across a membrane. - GO:1903401 L-lysine transmembrane transport
The directed movement of L-lysine across a membrane. - GO:1903713 Asparagine transmembrane transport
The directed movement of asparagine across a membrane. - GO:1903785 L-valine transmembrane transport
The directed movement of L-valine across a membrane.
Protein Sequence
>B5BP47 MNVQKSNNAEETITPFSEESSLLNSNSYIPATFVDPTTIPQTSTEDIDIHGFNSIFDIPNLAWIEVSLLLNVFLAGFDGT VTASAYTTIGEEFHAANLASWITTSYLITSTTFQPLYGSFSDVLGRRVCLFMASGLFCLGCLWCYFSSGMVSLIFARSFM GIGGGGLITLSTIINSDIIPTRNRGLFQAFQNLLLGFGAICGASFGGVLSEVFSWRLCFLVQVPFSVLSIAVGFFFVKNQ SGYSRFHHYCVLFKKIDILGGLLLVSGLTSLLLVLTFGSSRSIQTYRPSQLLLLLGILCIVAFVYVESITEAAPIIPLKL LKGLYSSLVLTTGFLIGLAGYAYLFTLPLFFQLVLGDSPSKAGLRLALPSLSTPIGGLICGILMHRNFRVGKLLFSGVFL MSLGYFLSLFIHPGISPIVLGIFLIPANVGQGIGFPSSLFSFIFAFPQNSHATSTSTLYLIRSIGSLFGVGGLSAVIQLT LRKKMLADLTKFTDLDSKSIQKIIHDVSKSISALYELPEAIQEIVLSDYTFSIRKAQQFTTICCVLALGLCILKDTIKPR TPSGFRY