Genome3D
Schizosaccharomyces pombe 972h-

spo2 Sporulation-specific protein 2

UniProt Data

Accession C6Y4C2 [ UniProt ]
Name SPO2_SCHPO
Description Sporulation-specific protein 2
Species Schizosaccharomyces pombe 972h-
Sequence Length133

Enzyme Annotations (0)

    GO Annotations

    Cellular component (1)

    None predicted

    Molecular function (1)

    None predicted

    Biological process (3)

    • GO:0030437 Ascospore formation
      The process in which cells that are products of meiosis acquire the specialized features of ascospores. Ascospores are generally found in clusters of four or eight spores within a single mother cell, the ascus, and are characteristic of the ascomycete fungi (phylum Ascomycota).
    • GO:0031322 Ascospore-type prospore-specific spindle pole body remodeling
      A spindle pole body (SPB) organization process that takes place during the second meiotic division during ascospore formation and results in the structural reorganization of the SPB; includes the recruitment of sporulation-specific proteins to the outer plaque to form the meiotic outer plaque (MOP).
    • GO:0034613 Cellular protein localization
      Any process in which a protein is transported to, and/or maintained in, a specific location at the level of a cell. Localization at the cellular level encompasses movement within the cell, from within the cell to the cell surface, or from one location to another at the surface of a cell.

    Protein Sequence

    >C6Y4C2
MSITMSDSSAYGEELMRERFEHLLKAYEKMALMVAEQEEFNAKIEDMALKLLSEKYDNEAYQAELFYRLSNCVEKVLHNK
ISITDLKTEYEEILEQTLKKECKAYERSCIENVKLKKRTEQATAYYASSSSEP