Genome3D
Schizosaccharomyces pombe 972h-

C6Y4C4 Succinate dehydrogenase assembly factor 4, mitochondrial

UniProt Data

Accession C6Y4C4 [ UniProt ]
Name SDHF4_SCHPO
Description Succinate dehydrogenase assembly factor 4, mitochondrial
Species Schizosaccharomyces pombe 972h-
Sequence Length100

Enzyme Annotations (0)

    GO Annotations

    Cellular component (2)

    • GO:0005739 Mitochondrion
      A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
    • GO:0005759 Mitochondrial matrix
      The gel-like material, with considerable fine structure, that lies in the matrix space, or lumen, of a mitochondrion. It contains the enzymes of the tricarboxylic acid cycle and, in some organisms, the enzymes concerned with fatty acid oxidation.

    Molecular function (1)

    None predicted

    Biological process (1)

    None predicted

    Protein Sequence

    >C6Y4C4
MFNRNLRAVILKNYNKALTRCLHDAGNLKRPTPPRLPKEQQEEWDRLQKESSKRPVDVMRREKHKDFEGDVNPKTGEIGG
PKSEPTVHGDYSYEGRVTDF