spo13 Sporulation-specific protein 13

• Overview
• Annotations

UniProt Data

Enzyme Annotations (0)

GO Annotations

Cellular component (1)

Molecular function (2)

• GO:0005085 Guanyl-nucleotide exchange factor activity
  Stimulates the exchange of guanyl nucleotides associated with a GTPase. Under normal cellular physiological conditions, the concentration of GTP is higher than that of GDP, favoring the replacement of GDP by GTP in association with the GTPase.
• GO:0005515 Protein binding
  Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).

Biological process (4)

• GO:0030437 Ascospore formation
  The process in which cells that are products of meiosis acquire the specialized features of ascospores. Ascospores are generally found in clusters of four or eight spores within a single mother cell, the ascus, and are characteristic of the ascomycete fungi (phylum Ascomycota).
• GO:0031322 Ascospore-type prospore-specific spindle pole body remodeling
  A spindle pole body (SPB) organization process that takes place during the second meiotic division during ascospore formation and results in the structural reorganization of the SPB; includes the recruitment of sporulation-specific proteins to the outer plaque to form the meiotic outer plaque (MOP).
• GO:0032120 Ascospore-type prospore membrane assembly
  The process in which the nascent membrane forms at the meiotic outer plaque and grows until closure occurs and forespores, or prospores, are formed.
• GO:1902441 Protein localization to meiotic spindle pole body
  A process in which a protein is transported to, or maintained in, a location within a meiotic spindle pole body.

Protein Sequence

>C6Y4C9
MMSNSQISKLFSSISNKENSNENALKESTNKQLNNANTLAITHLKEQLSREVQRREELEGLLEQSQKEMEDLSVSLFTEA
NEMVAKARQDTEVLKRELDYLRAKEKGRIGKLRSIQTAVRTSIEARKLLSYSNESNYH