PIK3R2 Phosphatidylinositol 3-kinase regulatory subunit beta
UniProt Data
Accession | O00459 [ UniProt ] |
Name | P85B_HUMAN |
Description | Phosphatidylinositol 3-kinase regulatory subunit beta |
Species | Homo sapiens |
Sequence Length | 728 |
Enzyme Annotations (0)
GO Annotations
Cellular component (2)
- GO:0005634 Nucleus
A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent. - GO:0005829 Cytosol
The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
Molecular function (8)
- GO:0001784 Phosphotyrosine binding
Interacting selectively and non-covalently with a phosphorylated tyrosine residue within a protein. - GO:0005096 GTPase activator activity
Binds to and increases the activity of a GTPase, an enzyme that catalyzes the hydrolysis of GTP. - GO:0005515 Protein binding
Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules). - GO:0016303 1-phosphatidylinositol-3-kinase activity
Catalysis of the reaction: 1-phosphatidyl-1D-myo-inositol + ATP = a 1-phosphatidyl-1D-myo-inositol 3-phosphate + ADP + 2 H(+). - GO:0019903 Protein phosphatase binding
Interacting selectively and non-covalently with any protein phosphatase. - GO:0030971 Receptor tyrosine kinase binding
Interacting selectively and non-covalently with a receptor that possesses protein tyrosine kinase activity. - GO:0046934 Phosphatidylinositol-4,5-bisphosphate 3-kinase activity
Catalysis of the reaction: 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + ATP = a 1-phosphatidyl-1D-myo-inositol 3,4,5-trisphosphate + ADP + 2 H(+). - GO:0046982 Protein heterodimerization activity
Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
Biological process (18)
- GO:0001678 Cellular glucose homeostasis
A cellular homeostatic process involved in the maintenance of an internal steady state of glucose within a cell or between a cell and its external environment. - GO:0006661 Phosphatidylinositol biosynthetic process
The chemical reactions and pathways resulting in the formation of phosphatidylinositol, any glycophospholipid in which the sn-glycerol 3-phosphate residue is esterified to the 1-hydroxyl group of 1D-myo-inositol. - GO:0010506 Regulation of autophagy
Any process that modulates the frequency, rate or extent of autophagy. Autophagy is the process in which cells digest parts of their own cytoplasm. - GO:0014065 Phosphatidylinositol 3-kinase signaling
A series of reactions within the signal-receiving cell, mediated by the intracellular phosphatidylinositol 3-kinase (PI3K). Many cell surface receptor linked signaling pathways signal through PI3K to regulate numerous cellular functions. - GO:0014066 Regulation of phosphatidylinositol 3-kinase signaling
Any process that modulates the frequency, rate or extent of signal transduction mediated by the phosphatidylinositol 3-kinase cascade. - GO:0032869 Cellular response to insulin stimulus
Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an insulin stimulus. Insulin is a polypeptide hormone produced by the islets of Langerhans of the pancreas in mammals, and by the homologous organs of other organisms. - GO:0034976 Response to endoplasmic reticulum stress
Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stress acting at the endoplasmic reticulum. ER stress usually results from the accumulation of unfolded or misfolded proteins in the ER lumen. - GO:0038095 Fc-epsilon receptor signaling pathway
A series of molecular signals initiated by the binding of the Fc portion of immunoglobulin E (IgE) to an Fc-epsilon receptor on the surface of a signal-receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription. The Fc portion of an immunoglobulin is its C-terminal constant region. - GO:0038096 Fc-gamma receptor signaling pathway involved in phagocytosis
An Fc-gamma receptor signaling pathway that contributes to the endocytic engulfment of external particulate material by phagocytes. - GO:0042993 Positive regulation of transcription factor import into nucleus
Any process that activates or increases the frequency, rate or extent of the movement of a transcription factor from the cytoplasm to the nucleus. - GO:0043065 Positive regulation of apoptotic process
Any process that activates or increases the frequency, rate or extent of cell death by apoptotic process. - GO:0045944 Positive regulation of transcription from RNA polymerase II promoter
Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter. - GO:0048010 Vascular endothelial growth factor receptor signaling pathway
Any series of molecular signals initiated by the binding of an extracellular ligand to a vascular endothelial growth factor receptor (VEGFR) located on the surface of the receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription. - GO:0048015 Phosphatidylinositol-mediated signaling
A series of molecular signals in which a cell uses a phosphatidylinositol-mediated signaling to convert a signal into a response. Phosphatidylinositols include phosphatidylinositol (PtdIns) and its phosphorylated derivatives. - GO:0050852 T cell receptor signaling pathway
A series of molecular signals initiated by the cross-linking of an antigen receptor on a T cell. - GO:0050900 Leukocyte migration
The movement of a leukocyte within or between different tissues and organs of the body. - GO:0051056 Regulation of small GTPase mediated signal transduction
Any process that modulates the frequency, rate or extent of small GTPase mediated signal transduction. - GO:2001275 Positive regulation of glucose import in response to insulin stimulus
Any process that activates or increases the frequency, rate or extent of glucose import in response to insulin stimulus.
Protein Sequence
>O00459 MAGPEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGGERCPQSVGWMPGLNERTRQRGDFPGTYVEFLGP VALARPGPRPRGPRPLPARPRDGAPEPGLTLPDLPEQFSPPDVAPPLLVKLVEAIERTGLDSESHYRPELPAPRTDWSLS DVDQWDTAALADGIKSFLLALPAPLVTPEASAEARRALREAAGPVGPALEPPTLPLHRALTLRFLLQHLGRVASRAPALG PAVRALGATFGPLLLRAPPPPSSPPPGGAPDGSEPSPDFPALLVEKLLQEHLEEQEVAPPALPPKPPKAKPASTVLANGG SPPSLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDASSKIQGEYTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVD LINHYRHESLAQYNAKLDTRLLYPVSKYQQDQIVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTA IEAFNETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRTKLEQQLRAQASDNREIDKRM NSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKNETEDQYALMEDEDDLPHHEERTWYVGKINRTQAEEMLSGKR DGTFLIRESSQRGCYACSVVVDGDTKHCVIYRTATGFGFAEPYNLYGSLKELVLHYQHASLVQHNDALTVTLAHPVRAPG PGPPPAAR