csh3 Protein csh3
UniProt Data
Accession | O43125 [ UniProt ] |
Name | CSH3_SCHPO |
Description | Protein csh3 |
Species | Schizosaccharomyces pombe 972h- |
Sequence Length | 296 |
Enzyme Annotations (0)
GO Annotations
Cellular component (2)
- GO:0005737 Cytoplasm
All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures. - GO:0005829 Cytosol
The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
Molecular function (1)
None predictedBiological process (1)
None predictedProtein Sequence
>O43125 MDHKNYLNHVIRGIYNDFQFLVDEGVVERSALDWVHANIHLQDGPASPVTAPAAQPVESSVPLPLPKRKSSVEKRAGSVA SAVAAMSLSQNSGEKRTPEEPRKLPGVPAPQKQSEASSVNSSTEKLPPPPSYPGPNTAHKNVERVLAMYDFPGPDAGDLG FHAGEVIIVLEHVNNDWWRGELNGKEGIFPSNYVRLLEDSAVKAQPPPPPPQQNYPPAASSSAPPMQYQQTAYPPQQAPY PPVQAYPQAPQQPIVVAQPTEHKHSSTFKKIGSGLGSAFVFGAGATAGADLVNSIF