Genome3D
Schizosaccharomyces pombe 972h-

hob1 Protein hob1

UniProt Data

Accession O74352 [ UniProt ]
Name HOB1_SCHPO
Description Protein hob1
Species Schizosaccharomyces pombe 972h-
Sequence Length466

Enzyme Annotations (0)

    GO Annotations

    Cellular component (2)

    • GO:0031097 Medial cortex
      A medial cortical band overlaying the nucleus which acts as a landmark for contractile ring positioning and plays a role in cell cycle regulation.
    • GO:0051285 Cell cortex of cell tip
      The region directly beneath the plasma membrane at the cell tip. The cell tip is the region at either end of the longest axis of a cylindrical or elongated cell.

    Molecular function (2)

    • GO:0005515 Protein binding
      Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    • GO:0051020 GTPase binding
      Interacting selectively and non-covalently with a GTPase, any enzyme that catalyzes the hydrolysis of GTP.

    Biological process (5)

    • GO:0006348 Chromatin silencing at telomere
      Repression of transcription of telomeric DNA by altering the structure of chromatin.
    • GO:0006974 Cellular response to DNA damage stimulus
      Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
    • GO:0006974 Cellular response to DNA damage stimulus
      Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
    • GO:0030702 Chromatin silencing at centromere
      Repression of transcription of centromeric DNA by altering the structure of chromatin.
    • GO:0071963 Establishment or maintenance of cell polarity regulating cell shape
      Any cellular process that results in the specification, formation or maintenance of a polarized intracellular organization or cell growth patterns that regulate the shape of a cell.

    Protein Sequence

    >O74352
MSWKGFTKALARTPQTLRSKFNVGEITKDPIYEDAGRRFKSLETEAKKLAEDAKKYTDAINGLLNHQIGFADACIEIYKP
ISGRASDPESYEQEGNAEGIEAAEAYKEIVYDLQKNLASEMDVINTRIVNPTGELLKIVKDVDKLLLKRDHKQLDYDRHR
SSFKKLQEKKDKSLKDEKKLYEAETAFEQSSQEYEYYNEMLKEELPKLFALAQSFIAPLFQGFYYMQLNVYYVLYEKMSH
CEIQYFDFNTDILESYERRRGDVKDRAEALTITKFKTAKPTYKRPGMGPGGKDATASSSSSFSSKREEAAAEPSSSTATD
IPPPYSTPSVAGASDYSTPSAGYQTVQTTTTTTEAAAAQYPQAAFPPPPVMPQPAAAAVTTPVAAPVAAAAAAVPVPPPA
PAPAAAPAAEHVVALYDYAAQAAGDLSFHAGDRIEVVSRTDNQNEWWIGRLNGAQGQFPGNYVQLE