hse1 Class E vacuolar protein-sorting machinery protein hse1
UniProt Data
Accession | O74749 [ UniProt ] |
Name | HSE1_SCHPO |
Description | Class E vacuolar protein-sorting machinery protein hse1 |
Species | Schizosaccharomyces pombe 972h- |
Sequence Length | 373 |
Enzyme Annotations (0)
GO Annotations
Cellular component (8)
- GO:0005628 Prospore membrane
The prospore membrane is a double-membraned structure that extends from the cytoplasmic face of the spindle pole bodies to encompass the spindle pole bodies and the four nuclear lobes that are formed during meiosis. It helps isolate the meiotic nuclei from the cytoplasm during spore formation and serves as a foundation for the formation of the spore walls. An example of this component is found in Schizosaccharomyces pombe. - GO:0005634 Nucleus
A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent. - GO:0005737 Cytoplasm
All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures. - GO:0005768 Endosome
A vacuole to which materials ingested by endocytosis are delivered. - GO:0005774 Vacuolar membrane
The lipid bilayer surrounding the vacuole and separating its contents from the cytoplasm of the cell. - GO:0005794 Golgi apparatus
A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions. - GO:0005829 Cytosol
The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes. - GO:0033565 ESCRT-0 complex
A protein complex required for the recycling of Golgi proteins, formation of lumenal membranes and sorting of ubiquitinated proteins into those membranes. This complex includes Vps1p and Hse1p in yeast and the Hrs and STAM proteins in mammals.
Molecular function (1)
None predictedBiological process (4)
- GO:0006900 Membrane budding
The evagination of a membrane, resulting in formation of a vesicle. - GO:0031321 Ascospore-type prospore assembly
During ascospore formation, the process in which each haploid nucleus becomes encapsulated by a double membrane. - GO:0043328 Protein targeting to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
The process of directing proteins towards the vacuole using signals contained within the protein, occurring that contributes to protein catabolism via the multivesicular body (MVB) pathway. - GO:0045324 Late endosome to vacuole transport
The directed movement of substances from late endosomes to the vacuole. In yeast, after transport to the prevacuolar compartment, endocytic content is delivered to the late endosome and on to the vacuole. This pathway is analogous to endosome to lysosome transport.
Protein Sequence
>O74749 MFRGKPNSIETLILQATDEKNTKEKWDVIMDACDQLSSTSGDVGRNSIKFLNKRLDTANANIQLLALTLTDAIVKNCKTS IVREISSRTFTDSLLKIASDSTTHNRVRSRIAVLVNEWAEIMKKDPNMSLMQDICEKIRKLDIVDLRAPKKPEKEAMNEL ELKREEEELQYALALSLSESTAQSNKVENPQSTKDEPLQKTNQRQESNLATSPASTVSRVRALYDFAATEQGELSFKKGD IILVLESVYKDWWKGSCKNAVGIFPVNYVQRVVEPTIEQQRQSAHMEQQVFDALPQIDELLDTLSTTSPDAADDDALQGK YHAMIALRPKLVRLIEKYASQKEELMDLNERLLVARRDYEKLYEQSMSEMRNF