GRAP2 GRB2-related adapter protein 2
UniProt Data
Accession | O75791 [ UniProt ] |
Name | GRAP2_HUMAN |
Description | GRB2-related adapter protein 2 |
Species | Homo sapiens |
Sequence Length | 330 |
Enzyme Annotations (0)
GO Annotations
Cellular component (5)
- GO:0005634 Nucleus
A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent. - GO:0005737 Cytoplasm
All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures. - GO:0005737 Cytoplasm
All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures. - GO:0005768 Endosome
A vacuole to which materials ingested by endocytosis are delivered. - GO:0005829 Cytosol
The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
Molecular function (2)
- GO:0005070 SH3/SH2 adaptor activity
Interacting selectively and non-covalently and simultaneously with one or more signal transduction molecules, usually acting as a scaffold to bring these molecules into close proximity either using their own SH2/SH3 domains (e.g. Grb2) or those of their target molecules (e.g. SAM68). - GO:0005515 Protein binding
Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
Biological process (5)
- GO:0007265 Ras protein signal transduction
A series of molecular signals within the cell that are mediated by a member of the Ras superfamily of proteins switching to a GTP-bound active state. - GO:0007267 Cell-cell signaling
Any process that mediates the transfer of information from one cell to another. This process includes signal transduction in the receiving cell and, where applicable, release of a ligand and any processes that actively facilitate its transport and presentation to the receiving cell. Examples include signaling via soluble ligands, via cell adhesion molecules and via gap junctions. - GO:0031295 T cell costimulation
The process of providing, via surface-bound receptor-ligand pairs, a second, antigen-independent, signal in addition to that provided by the T cell receptor to augment T cell activation. - GO:0038095 Fc-epsilon receptor signaling pathway
A series of molecular signals initiated by the binding of the Fc portion of immunoglobulin E (IgE) to an Fc-epsilon receptor on the surface of a signal-receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription. The Fc portion of an immunoglobulin is its C-terminal constant region. - GO:0050852 T cell receptor signaling pathway
A series of molecular signals initiated by the cross-linking of an antigen receptor on a T cell.
Protein Sequence
>O75791 MEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIQFPKWFHEGLSRHQAENLLMGKEVGFF IIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSL DRRSQGGPHLSGAVGEEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQYAPAPQQLQQPPQQRYLQHHHFHQERRGGSLDIN DGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFEALEDDELGFHSGEVVEVLDSSNPSWWTGRLHNKLGLF PANYVAPMTR