HCK Tyrosine-protein kinase HCK

• Overview
• Annotations

UniProt Data

Enzyme Annotations (1)

• EC:2.7.10.2 Non-specific protein-tyrosine kinase.
  ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.

GO Annotations

Cellular component (7)

• GO:0005654 Nucleoplasm
  That part of the nuclear content other than the chromosomes or the nucleolus.
• GO:0005764 Lysosome
  A small lytic vacuole that has cell cycle-independent morphology and is found in most animal cells and that contains a variety of hydrolases, most of which have their maximal activities in the pH range 5-6. The contained enzymes display latency if properly isolated. About 40 different lysosomal hydrolases are known and lysosomes have a great variety of morphologies and functions.
• GO:0005829 Cytosol
  The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
• GO:0005886 Plasma membrane
  The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
• GO:0005901 Caveola
  A membrane raft that forms small pit, depression, or invagination that communicates with the outside of a cell and extends inward, indenting the cytoplasm and the cell membrane. Examples include flask-shaped invaginations of the plasma membrane in adipocytes associated with caveolin proteins, and minute pits or incuppings of the cell membrane formed during pinocytosis. Caveolae may be pinched off to form free vesicles within the cytoplasm.
• GO:0005925 Focal adhesion
  Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
• GO:0031234 Extrinsic component of cytoplasmic side of plasma membrane
  The component of a plasma membrane consisting of gene products and protein complexes that are loosely bound to its cytoplasmic surface, but not integrated into the hydrophobic region.

Molecular function (5)

• GO:0001784 Phosphotyrosine binding
  Interacting selectively and non-covalently with a phosphorylated tyrosine residue within a protein.
• GO:0004713 Protein tyrosine kinase activity
  Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
• GO:0004713 Protein tyrosine kinase activity
  Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
• GO:0004713 Protein tyrosine kinase activity
  Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
• GO:0005515 Protein binding
  Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).

Biological process (25)

• GO:0002522 Leukocyte migration involved in immune response
  The movement of a leukocyte within or between different tissues and organs of the body as part of an immune response.
• GO:0002758 Innate immune response-activating signal transduction
  The cascade of processes by which a signal interacts with a receptor, causing a change in the level or activity of a second messenger or other downstream target, and ultimately leading to activation or perpetuation of an innate immune response.
• GO:0006468 Protein phosphorylation
  The process of introducing a phosphate group on to a protein.
• GO:0007155 Cell adhesion
  The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
• GO:0007229 Integrin-mediated signaling pathway
  A series of molecular signals initiated by the binding of extracellular ligand to an integrin on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
• GO:0007498 Mesoderm development
  The process whose specific outcome is the progression of the mesoderm over time, from its formation to the mature structure. The mesoderm is the middle germ layer that develops into muscle, bone, cartilage, blood and connective tissue.
• GO:0008284 Positive regulation of cell proliferation
  Any process that activates or increases the rate or extent of cell proliferation.
• GO:0008360 Regulation of cell shape
  Any process that modulates the surface configuration of a cell.
• GO:0018108 Peptidyl-tyrosine phosphorylation
  The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine.
• GO:0019221 Cytokine-mediated signaling pathway
  A series of molecular signals initiated by the binding of a cytokine to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
• GO:0030838 Positive regulation of actin filament polymerization
  Any process that activates or increases the frequency, rate or extent of actin polymerization.
• GO:0031663 Lipopolysaccharide-mediated signaling pathway
  A series of molecular signals initiated by the binding of a lipopolysaccharide (LPS) to a receptor on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription. Lipopolysaccharides are major components of the outer membrane of Gram-negative bacteria, making them prime targets for recognition by the immune system.
• GO:0038096 Fc-gamma receptor signaling pathway involved in phagocytosis
  An Fc-gamma receptor signaling pathway that contributes to the endocytic engulfment of external particulate material by phagocytes.
• GO:0043066 Negative regulation of apoptotic process
  Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
• GO:0043299 Leukocyte degranulation
  The regulated exocytosis of secretory granules by a leukocyte.
• GO:0045728 Respiratory burst after phagocytosis
  A phase of elevated metabolic activity, during which oxygen consumption increases, that occurs in neutrophils, monocytes, and macrophages shortly after phagocytosing material. An enhanced uptake of oxygen leads to the production, by an NADH dependent system, of hydrogen peroxide (H2O2), superoxide anions and hydroxyl radicals, which play a part in microbiocidal activity.
• GO:0046777 Protein autophosphorylation
  The phosphorylation by a protein of one or more of its own amino acid residues (cis-autophosphorylation), or residues on an identical protein (trans-autophosphorylation).
• GO:0050690 Regulation of defense response to virus by virus
  Any viral process that modulates the frequency, rate, or extent of the antiviral response of the host cell or organism.
• GO:0050727 Regulation of inflammatory response
  Any process that modulates the frequency, rate or extent of the inflammatory response, the immediate defensive reaction (by vertebrate tissue) to infection or injury caused by chemical or physical agents.
• GO:0050764 Regulation of phagocytosis
  Any process that modulates the frequency, rate or extent of phagocytosis, the process in which phagocytes engulf external particulate material.
• GO:0051090 Regulation of sequence-specific DNA binding transcription factor activity
  Any process that modulates the frequency, rate or extent of the activity of a transcription factor, any factor involved in the initiation or regulation of transcription.
• GO:0060333 Interferon-gamma-mediated signaling pathway
  A series of molecular signals initiated by the binding of interferon-gamma to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription. Interferon gamma is the only member of the type II interferon found so far.
• GO:0071801 Regulation of podosome assembly
  Any process that modulates the frequency, rate or extent of podosome assembly.
• GO:2000251 Positive regulation of actin cytoskeleton reorganization
  Any process that activates or increases the frequency, rate or extent of actin cytoskeleton reorganization.
• GO:2000251 Positive regulation of actin cytoskeleton reorganization
  Any process that activates or increases the frequency, rate or extent of actin cytoskeleton reorganization.

Protein Sequence

>P08631
MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTPGIREAGSED
IIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEEWFFKGISRKDAERQLLA
PGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGDTVKHYKIRTLDNGGFYISPRSTFSTLQELVDHYKKGNDGLCQKLSVP
CMSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAFLAEANVMKTLQHDKLVKL
HAVVTKEPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLIDFSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADF
GLARVIEDNEYTAREGAKFPIKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPE
NCPEELYNIMMRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP