RASA1 Ras GTPase-activating protein 1
UniProt Data
| Accession | P20936 [ UniProt ] |
| Name | RASA1_HUMAN |
| Description | Ras GTPase-activating protein 1 |
| Species | Homo sapiens |
| Sequence Length | 1047 |
Enzyme Annotations (0)
GO Annotations
Cellular component (2)
- GO:0005737 Cytoplasm
All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures. - GO:0005829 Cytosol
The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
Molecular function (8)
- GO:0001784 Phosphotyrosine binding
Interacting selectively and non-covalently with a phosphorylated tyrosine residue within a protein. - GO:0001948 Glycoprotein binding
Interacting selectively and non-covalently with a glycoprotein, a protein that contains covalently bound glycose (monosaccharide) residues. These also include proteoglycans. - GO:0005096 GTPase activator activity
Binds to and increases the activity of a GTPase, an enzyme that catalyzes the hydrolysis of GTP. - GO:0005096 GTPase activator activity
Binds to and increases the activity of a GTPase, an enzyme that catalyzes the hydrolysis of GTP. - GO:0005102 Receptor binding
Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function. - GO:0005515 Protein binding
Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules). - GO:0019870 Potassium channel inhibitor activity
Stops, prevents, or reduces the activity of a potassium channel. - GO:0051020 GTPase binding
Interacting selectively and non-covalently with a GTPase, any enzyme that catalyzes the hydrolysis of GTP.
Biological process (15)
- GO:0000165 MAPK cascade
An intracellular protein kinase cascade containing at least a MAPK, a MAPKK and a MAP3K. The cascade can also contain two additional tiers: the upstream MAP4K and the downstream MAP Kinase-activated kinase (MAPKAPK). The kinases in each tier phosphorylate and activate the kinases in the downstream tier to transmit a signal within a cell. - GO:0000281 Mitotic cytokinesis
A cell cycle process that results in the division of the cytoplasm of a cell after mitosis, resulting in the separation of the original cell into two daughter cells. - GO:0001570 Vasculogenesis
The differentiation of endothelial cells from progenitor cells during blood vessel development, and the de novo formation of blood vessels and tubes. - GO:0001953 Negative regulation of cell-matrix adhesion
Any process that stops, prevents, or reduces the rate or extent of cell adhesion to the extracellular matrix. - GO:0007162 Negative regulation of cell adhesion
Any process that stops, prevents, or reduces the frequency, rate or extent of cell adhesion. - GO:0007165 Signal transduction
The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell. - GO:0008360 Regulation of cell shape
Any process that modulates the surface configuration of a cell. - GO:0009790 Embryo development
The process whose specific outcome is the progression of an embryo from its formation until the end of its embryonic life stage. The end of the embryonic stage is organism-specific. For example, for mammals, the process would begin with zygote formation and end with birth. For insects, the process would begin at zygote formation and end with larval hatching. For plant zygotic embryos, this would be from zygote formation to the end of seed dormancy. For plant vegetative embryos, this would be from the initial determination of the cell or group of cells to form an embryo until the point when the embryo becomes independent of the parent plant. - GO:0030833 Regulation of actin filament polymerization
Any process that modulates the frequency, rate or extent of the assembly of actin filaments by the addition of actin monomers to a filament. - GO:0035556 Intracellular signal transduction
The process in which a signal is passed on to downstream components within the cell, which become activated themselves to further propagate the signal and finally trigger a change in the function or state of the cell. - GO:0043066 Negative regulation of apoptotic process
Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process. - GO:0043524 Negative regulation of neuron apoptotic process
Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process in neurons. - GO:0048013 Ephrin receptor signaling pathway
The series of molecular signals generated as a consequence of an ephrin receptor binding to an ephrin. - GO:0048514 Blood vessel morphogenesis
The process in which the anatomical structures of blood vessels are generated and organized. The blood vessel is the vasculature carrying blood. - GO:0051252 Regulation of RNA metabolic process
Any process that modulates the frequency, rate or extent of the chemical reactions and pathways involving RNA.
Protein Sequence
>P20936 MMAAEAGSEEGGPVTAGAGGGGAAAGSSAYPAVCRVKIPAALPVAAAPYPGLVETGVAGTLGGGAALGSEFLGAGSVAGA LGGAGLTGGGTAAGVAGAAAGVAGAAVAGPSGDMALTKLPTSLLAETLGPGGGFPPLPPPPYLPPLGAGLGTVDEGDSLD GPEYEEEEVAIPLTAPPTNQWYHGKLDRTIAEERLRQAGKSGSYLIRESDRRPGSFVLSFLSQMNVVNHFRIIAMCGDYY IGGRRFSSLSDLIGYYSHVSCLLKGEKLLYPVAPPEPVEDRRRVRAILPYTKVPDTDEISFLKGDMFIVHNELEDGWMWV TNLRTDEQGLIVEDLVEEVGREEDPHEGKIWFHGKISKQEAYNLLMTVGQVCSFLVRPSDNTPGDYSLYFRTNENIQRFK ICPTPNNQFMMGGRYYNSIGDIIDHYRKEQIVEGYYLKEPVPMQDQEQVLNDTVDGKEIYNTIRRKTKDAFYKNIVKKGY LLKKGKGKRWKNLYFILEGSDAQLIYFESEKRATKPKGLIDLSVCSVYVVHDSLFGRPNCFQIVVQHFSEEHYIFYFAGE TPEQAEDWMKGLQAFCNLRKSSPGTSNKRLRQVSSLVLHIEEAHKLPVKHFTNPYCNIYLNSVQVAKTHAREGQNPVWSE EFVFDDLPPDINRFEITLSNKTKKSKDPDILFMRCQLSRLQKGHATDEWFLLSSHIPLKGIEPGSLRVRARYSMEKIMPE EEYSEFKELILQKELHVVYALSHVCGQDRTLLASILLRIFLHEKLESLLLCTLNDREISMEDEATTLFRATTLASTLMEQ YMKATATQFVHHALKDSILKIMESKQSCELSPSKLEKNEDVNTNLTHLLNILSELVEKIFMASEILPPTLRYIYGCLQKS VQHKWPTNTTMRTRVVSGFVFLRLICPAILNPRMFNIISDSPSPIAARTLILVAKSVQNLANLVEFGAKEPYMEGVNPFI KSNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERGAQQHVLKKLLAITELLQQKQNQY TKTNDVR
