PIK3R1 Phosphatidylinositol 3-kinase regulatory subunit alpha
UniProt Data
Accession | P27986 [ UniProt ] |
Name | P85A_HUMAN |
Description | Phosphatidylinositol 3-kinase regulatory subunit alpha |
Species | Homo sapiens |
Sequence Length | 724 |
Enzyme Annotations (0)
GO Annotations
Cellular component (7)
- GO:0005634 Nucleus
A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent. - GO:0005737 Cytoplasm
All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures. - GO:0005829 Cytosol
The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes. - GO:0005886 Plasma membrane
The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins. - GO:0005942 Phosphatidylinositol 3-kinase complex
A protein complex capable of phosphatidylinositol 3-kinase activity and containing subunits of any phosphatidylinositol 3-kinase (PI3K) enzyme. These complexes are divided in three classes (called I, II and III) that differ for their presence across taxonomic groups and for the type of their constituents. Catalytic subunits of phosphatidylinositol 3-kinase enzymes are present in all 3 classes; regulatory subunits of phosphatidylinositol 3-kinase enzymes are present in classes I and III; adaptor proteins have been observed in class II complexes and may be present in other classes too. - GO:0005943 Phosphatidylinositol 3-kinase complex, class IA
A class I phosphatidylinositol 3-kinase complex that possesses 1-phosphatidylinositol-4-phosphate 3-kinase activity; comprises a catalytic class IA phosphoinositide 3-kinase (PI3K) subunit and an associated SH2 domain-containing regulatory subunit that is a member of a family of related proteins often called p85 proteins. Through the interaction with the SH2-containing adaptor subunits, Class IA PI3K catalytic subunits are linked to tyrosine kinase signaling pathways. - GO:0016020 Membrane
A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
Molecular function (15)
- GO:0001784 Phosphotyrosine binding
Interacting selectively and non-covalently with a phosphorylated tyrosine residue within a protein. - GO:0005068 Transmembrane receptor protein tyrosine kinase adaptor activity
The binding activity of a molecule that brings together a transmembrane receptor protein tyrosine kinase and one or more other molecules, permitting them to function in a coordinated way. - GO:0005158 Insulin receptor binding
Interacting selectively and non-covalently with the insulin receptor. - GO:0005159 Insulin-like growth factor receptor binding
Interacting selectively and non-covalently with the insulin-like growth factor receptor. - GO:0005168 Neurotrophin TRKA receptor binding
Interacting selectively and non-covalently with the neurotrophin TRKA receptor. - GO:0005515 Protein binding
Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules). - GO:0008134 Transcription factor binding
Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription. - GO:0016303 1-phosphatidylinositol-3-kinase activity
Catalysis of the reaction: 1-phosphatidyl-1D-myo-inositol + ATP = a 1-phosphatidyl-1D-myo-inositol 3-phosphate + ADP + 2 H(+). - GO:0019903 Protein phosphatase binding
Interacting selectively and non-covalently with any protein phosphatase. - GO:0035014 Phosphatidylinositol 3-kinase regulator activity
Modulates the activity of any of the phosphatidylinositol 3-kinases (PI3Ks). Regulatory subunits can link a PI3K catalytic subunit to upstream signaling events and help position the catalytic subunits close to their lipid substrates. - GO:0043125 ErbB-3 class receptor binding
Interacting selectively and non-covalently with the protein-tyrosine kinase receptor ErbB-3/HER3. - GO:0043548 Phosphatidylinositol 3-kinase binding
Interacting selectively and non-covalently with a phosphatidylinositol 3-kinase, any enzyme that catalyzes the addition of a phosphate group to an inositol lipid at the 3' position of the inositol ring. - GO:0043559 Insulin binding
Interacting selectively and non-covalently with insulin, a polypeptide hormone produced by the islets of Langerhans of the pancreas in mammals, and by the homologous organs of other organisms. - GO:0043560 Insulin receptor substrate binding
Interacting selectively and non-covalently with any of the insulin receptor substrate (IRS) proteins, adaptor proteins that bind to the transphosphorylated insulin and insulin-like growth factor receptors, are themselves phosphorylated and in turn recruit SH2 domain-containing signaling molecules to form a productive signaling complex. - GO:0046934 Phosphatidylinositol-4,5-bisphosphate 3-kinase activity
Catalysis of the reaction: 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + ATP = a 1-phosphatidyl-1D-myo-inositol 3,4,5-trisphosphate + ADP + 2 H(+).
Biological process (35)
- GO:0001678 Cellular glucose homeostasis
A cellular homeostatic process involved in the maintenance of an internal steady state of glucose within a cell or between a cell and its external environment. - GO:0006661 Phosphatidylinositol biosynthetic process
The chemical reactions and pathways resulting in the formation of phosphatidylinositol, any glycophospholipid in which the sn-glycerol 3-phosphate residue is esterified to the 1-hydroxyl group of 1D-myo-inositol. - GO:0007173 Epidermal growth factor receptor signaling pathway
A series of molecular signals initiated by binding of a ligand to the tyrosine kinase receptor EGFR (ERBB1) on the surface of a cell. The pathway ends with regulation of a downstream cellular process, e.g. transcription. - GO:0007411 Axon guidance
The chemotaxis process that directs the migration of an axon growth cone to a specific target site in response to a combination of attractive and repulsive cues. - GO:0014065 Phosphatidylinositol 3-kinase signaling
A series of reactions within the signal-receiving cell, mediated by the intracellular phosphatidylinositol 3-kinase (PI3K). Many cell surface receptor linked signaling pathways signal through PI3K to regulate numerous cellular functions. - GO:0014065 Phosphatidylinositol 3-kinase signaling
A series of reactions within the signal-receiving cell, mediated by the intracellular phosphatidylinositol 3-kinase (PI3K). Many cell surface receptor linked signaling pathways signal through PI3K to regulate numerous cellular functions. - GO:0014066 Regulation of phosphatidylinositol 3-kinase signaling
Any process that modulates the frequency, rate or extent of signal transduction mediated by the phosphatidylinositol 3-kinase cascade. - GO:0030168 Platelet activation
A series of progressive, overlapping events triggered by exposure of the platelets to subendothelial tissue. These events include shape change, adhesiveness, aggregation, and release reactions. When carried through to completion, these events lead to the formation of a stable hemostatic plug. - GO:0031295 T cell costimulation
The process of providing, via surface-bound receptor-ligand pairs, a second, antigen-independent, signal in addition to that provided by the T cell receptor to augment T cell activation. - GO:0032869 Cellular response to insulin stimulus
Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an insulin stimulus. Insulin is a polypeptide hormone produced by the islets of Langerhans of the pancreas in mammals, and by the homologous organs of other organisms. - GO:0033120 Positive regulation of RNA splicing
Any process that activates or increases the frequency, rate or extent of RNA splicing. - GO:0034976 Response to endoplasmic reticulum stress
Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stress acting at the endoplasmic reticulum. ER stress usually results from the accumulation of unfolded or misfolded proteins in the ER lumen. - GO:0034976 Response to endoplasmic reticulum stress
Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stress acting at the endoplasmic reticulum. ER stress usually results from the accumulation of unfolded or misfolded proteins in the ER lumen. - GO:0038095 Fc-epsilon receptor signaling pathway
A series of molecular signals initiated by the binding of the Fc portion of immunoglobulin E (IgE) to an Fc-epsilon receptor on the surface of a signal-receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription. The Fc portion of an immunoglobulin is its C-terminal constant region. - GO:0038096 Fc-gamma receptor signaling pathway involved in phagocytosis
An Fc-gamma receptor signaling pathway that contributes to the endocytic engulfment of external particulate material by phagocytes. - GO:0038128 ERBB2 signaling pathway
A series of molecular signals initiated by binding of a ligand to a member of the ERBB family of receptors on the surface of a cell, where the signal is transmitted by ERBB2. The pathway ends with regulation of a downstream cellular process, e.g. transcription. ERBB2 receptors are themselves unable to bind to ligands, but act as a signal-amplifying tyrosine kinase within a heterodimeric pair. - GO:0042993 Positive regulation of transcription factor import into nucleus
Any process that activates or increases the frequency, rate or extent of the movement of a transcription factor from the cytoplasm to the nucleus. - GO:0042993 Positive regulation of transcription factor import into nucleus
Any process that activates or increases the frequency, rate or extent of the movement of a transcription factor from the cytoplasm to the nucleus. - GO:0043066 Negative regulation of apoptotic process
Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process. - GO:0043551 Regulation of phosphatidylinositol 3-kinase activity
Any process that modulates the frequency, rate or extent of phosphatidylinositol 3-kinase activity, the catalysis of the transfer of a phosphate group, usually from ATP, to an inositol lipid at the 3' position of the inositol ring. - GO:0045944 Positive regulation of transcription from RNA polymerase II promoter
Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter. - GO:0045944 Positive regulation of transcription from RNA polymerase II promoter
Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter. - GO:0046326 Positive regulation of glucose import
Any process that activates or increases the frequency, rate or extent of the import of the hexose monosaccharide glucose into a cell or organelle. - GO:0046854 Phosphatidylinositol phosphorylation
The process of introducing one or more phosphate groups into a phosphatidylinositol, any glycerophosphoinositol having one phosphatidyl group esterified to one of the hydroxy groups of inositol. - GO:0048009 Insulin-like growth factor receptor signaling pathway
The series of molecular signals generated as a consequence of the insulin-like growth factor receptor binding to one of its physiological ligands. - GO:0048009 Insulin-like growth factor receptor signaling pathway
The series of molecular signals generated as a consequence of the insulin-like growth factor receptor binding to one of its physiological ligands. - GO:0048010 Vascular endothelial growth factor receptor signaling pathway
Any series of molecular signals initiated by the binding of an extracellular ligand to a vascular endothelial growth factor receptor (VEGFR) located on the surface of the receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription. - GO:0048015 Phosphatidylinositol-mediated signaling
A series of molecular signals in which a cell uses a phosphatidylinositol-mediated signaling to convert a signal into a response. Phosphatidylinositols include phosphatidylinositol (PtdIns) and its phosphorylated derivatives. - GO:0050821 Protein stabilization
Any process involved in maintaining the structure and integrity of a protein and preventing it from degradation or aggregation. - GO:0050852 T cell receptor signaling pathway
A series of molecular signals initiated by the cross-linking of an antigen receptor on a T cell. - GO:0050900 Leukocyte migration
The movement of a leukocyte within or between different tissues and organs of the body. - GO:0060396 Growth hormone receptor signaling pathway
The series of molecular signals generated as a consequence of growth hormone receptor binding to its physiological ligand. - GO:0090004 Positive regulation of establishment of protein localization to plasma membrane
Any process that increases the frequency, rate or extent of the directed movement of a protein to a specific location in the plasma membrane. - GO:1900103 Positive regulation of endoplasmic reticulum unfolded protein response
Any process that activates or increases the frequency, rate or extent of endoplasmic reticulum unfolded protein response. - GO:2001275 Positive regulation of glucose import in response to insulin stimulus
Any process that activates or increases the frequency, rate or extent of glucose import in response to insulin stimulus.
Protein Sequence
>P27986 MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTGERGDFPGTYVEYIGRK KISPPTPKPRPPRPLPVAPGSSKTEADVEQQALTLPDLAEQFAPPDIAPPLLIKLVEAIEKKGLECSTLYRTQSSSNLAE LRQLLDCDTPSVDLEMIDVHVLADAFKRYLLDLPNPVIPAAVYSEMISLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTL QYLLKHFFKLSQTSSKNLLNARVLSEIFSPMLFRFSAASSDNTENLIKVIEILISTEWNERQPAPALPPKPPKPTTVANN GMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSS VVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMK RTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYDKLKSRISEIIDSRRRLEEDLKKQAAEYREID KRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGNENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRG KRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA QQRR