Genome3D
Schizosaccharomyces pombe 972h-

scd2 Protein scd2/ral3

UniProt Data

Accession P40996 [ UniProt ]
Name SCD2_SCHPO
Description Protein scd2/ral3
Species Schizosaccharomyces pombe 972h-
Sequence Length536

Enzyme Annotations (0)

    GO Annotations

    Cellular component (7)

    • GO:0005634 Nucleus
      A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    • GO:0005829 Cytosol
      The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    • GO:0032153 Cell division site
      The eventual plane of cell division (also known as cell cleavage or cytokinesis) in a dividing cell. In Eukaryotes, the cleavage apparatus, composed of septin structures and the actomyosin contractile ring, forms along this plane, and the mitotic, or meiotic, spindle is aligned perpendicular to the division plane. In bacteria, the cell division site is generally located at mid-cell and is the site at which the cytoskeletal structure, the Z-ring, assembles.
    • GO:0043332 Mating projection tip
      The apex of the mating projection in unicellular fungi exposed to mating pheromone; site of polarized growth.
    • GO:0051286 Cell tip
      The region at the end of the longest axis of a cylindrical or elongated cell.
    • GO:0071521 Cdc42 GTPase complex
      A protein complex formed by the association of the small GTPase Cdc42 with additional proteins. In Schizosaccharomyces the complex contains the Cdc42, Ras1, Scd1, Scd2, andShk1 proteins, and functions in the Ras1-Scd GTPase signalling pathway.
    • GO:0090726 Cortical dynamic polarity patch
      A region of the cell cortex that contains a higher concentration of growth polarity factors than the surrounding cortex and that changes position over time. An example is found in fission yeast cells during early mating, in which the GTPase Cdc42 dynamically to discrete zones within the cortex prior to shmoo formation.

    Molecular function (2)

    • GO:0005515 Protein binding
      Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    • GO:0035091 Phosphatidylinositol binding
      Interacting selectively and non-covalently with any inositol-containing glycerophospholipid, i.e. phosphatidylinositol (PtdIns) and its phosphorylated derivatives.

    Biological process (5)

    • GO:0000747 Conjugation with cellular fusion
      A conjugation process that results in the union of cellular and genetic information from compatible mating types. An example of this process is found in Saccharomyces cerevisiae.
    • GO:0031139 Positive regulation of conjugation with cellular fusion
      Any process that increases the rate or frequency of conjugation with cellular fusion.
    • GO:0032005 Signal transduction involved in conjugation with cellular fusion
      The series of molecular signals that bring about the relay, amplification or dampening of a signal generated in response to a cue, such as starvation or pheromone exposure, in organisms that undergo conjugation with cellular fusion.
    • GO:0032488 Cdc42 protein signal transduction
      A series of molecular signals within the cell that are mediated by the Cdc42 protein switching to a GTP-bound active state.
    • GO:2000769 Regulation of establishment or maintenance of cell polarity regulating cell shape
      Any process that modulates the frequency, rate or extent of establishment or maintenance of cell polarity regulating cell shape.

    Protein Sequence

    >P40996
MLKIKRTWKTHSRILDKDPFSIEPPRKVIRALYDYTARKATEVSFAKGDFFHVIGRENDKAWYEVCNPAAGTRGFVPVSH
FEEIGKTVKSERDSDGSGQISFTDLTTNSSTTRSSISELHSGSQPLFGIVQFDFAAERPDELEAKAGEAIIIIARSNHEW
LVAKPIGRLGGPGLIPLSFIQLRDLKTGAVIKDVSEAVLRISCIPRVEDWKRAAADYKKSSIPLGKFSDGETQTMPSLSP
STENLQINNDVTYQAATDNSSTFPGSVANELTPLQTLESRTASIASKNKKDMSSEPTVVAAMVENYMIRDDQYWYLVRAV
MSDGKHRNLCRYYEDFFNFQTKFLELFPNEAGRGDERRVIPYMPGPVDDVNELISSQRAMDLDVYLKEMCRLPARLLENE
LVKLFFLPLDGDVESPHPTSTMPEALPREPLSFSLPEKAPEKATNISIPESAPTTAGSTCKVKVRLGDETFALRVPSDIS
FEDFCERLTNKLGECEHLSYRDTNANKVLPLNNVDDLRKACSQESGVLLFAERRRF