TEC Tyrosine-protein kinase Tec
UniProt Data
Accession | P42680 [ UniProt ] |
Name | TEC_HUMAN |
Description | Tyrosine-protein kinase Tec |
Species | Homo sapiens |
Sequence Length | 631 |
Enzyme Annotations (1)
- EC:2.7.10.2 Non-specific protein-tyrosine kinase.
ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.
GO Annotations
Cellular component (3)
- GO:0005829 Cytosol
The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes. - GO:0005856 Cytoskeleton
Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles. - GO:0005886 Plasma membrane
The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
Molecular function (4)
- GO:0004715 Non-membrane spanning protein tyrosine kinase activity
Catalysis of the reaction: ATP + protein L-tyrosine = ADP + protein L-tyrosine phosphate by a non-membrane spanning protein. - GO:0004715 Non-membrane spanning protein tyrosine kinase activity
Catalysis of the reaction: ATP + protein L-tyrosine = ADP + protein L-tyrosine phosphate by a non-membrane spanning protein. - GO:0005515 Protein binding
Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules). - GO:0005543 Phospholipid binding
Interacting selectively and non-covalently with phospholipids, a class of lipids containing phosphoric acid as a mono- or diester.
Biological process (9)
- GO:0006468 Protein phosphorylation
The process of introducing a phosphate group on to a protein. - GO:0007229 Integrin-mediated signaling pathway
A series of molecular signals initiated by the binding of extracellular ligand to an integrin on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription. - GO:0010543 Regulation of platelet activation
Any process that modulates the rate or frequency of platelet activation. Platelet activation is a series of progressive, overlapping events triggered by exposure of the platelets to subendothelial tissue. - GO:0018108 Peptidyl-tyrosine phosphorylation
The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine. - GO:0035556 Intracellular signal transduction
The process in which a signal is passed on to downstream components within the cell, which become activated themselves to further propagate the signal and finally trigger a change in the function or state of the cell. - GO:0038083 Peptidyl-tyrosine autophosphorylation
The phosphorylation by a protein of one or more of its own tyrosine amino acid residues, or a tyrosine residue on an identical protein. - GO:0038095 Fc-epsilon receptor signaling pathway
A series of molecular signals initiated by the binding of the Fc portion of immunoglobulin E (IgE) to an Fc-epsilon receptor on the surface of a signal-receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription. The Fc portion of an immunoglobulin is its C-terminal constant region. - GO:0050731 Positive regulation of peptidyl-tyrosine phosphorylation
Any process that activates or increases the frequency, rate or extent of the phosphorylation of peptidyl-tyrosine. - GO:0050853 B cell receptor signaling pathway
A series of molecular signals initiated by the cross-linking of an antigen receptor on a B cell.
Protein Sequence
>P42680 MNFNTILEEILIKRSQQKKKTSPLNYKERLFVLTKSMLTYYEGRAEKKYRKGFIDVSKIKCVEIVKNDDGVIPCQNKYPF QVVHDANTLYIFAPSPQSRDLWVKKLKEEIKNNNNIMIKYHPKFWTDGSYQCCRQTEKLAPGCEKYNLFESSIRKALPPA PETKKRRPPPPIPLEEEDNSEEIVVAMYDFQAAEGHDLRLERGQEYLILEKNDVHWWRARDKYGNEGYIPSNYVTGKKSN NLDQYEWYCRNMNRSKAEQLLRSEDKEGGFMVRDSSQPGLYTVSLYTKFGGEGSSGFRHYHIKETTTSPKKYYLAEKHAF GSIPEIIEYHKHNAAGLVTRLRYPVSVKGKNAPTTAGFSYEKWEINPSELTFMRELGSGLFGVVRLGKWRAQYKVAIKAI REGAMCEEDFIEEAKVMMKLTHPKLVQLYGVCTQQKPIYIVTEFMERGCLLNFLRQRQGHFSRDVLLSMCQDVCEGMEYL ERNSFIHRDLAARNCLVSEAGVVKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYSRFSSKSDVWSFGVLMWEVFT EGRMPFEKYTNYEVVTMVTRGHRLYQPKLASNYVYEVMLRCWQEKPEGRPSFEDLLRTIDELVECEETFGR