FRK Tyrosine-protein kinase FRK

• Overview
• Annotations

UniProt Data

Enzyme Annotations (1)

• EC:2.7.10.2 Non-specific protein-tyrosine kinase.
  ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.

GO Annotations

Cellular component (8)

• GO:0005576 Extracellular region
  The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
• GO:0005622 Intracellular
  The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
• GO:0005634 Nucleus
  A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
• GO:0005654 Nucleoplasm
  That part of the nuclear content other than the chromosomes or the nucleolus.
• GO:0005829 Cytosol
  The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
• GO:0035578 Azurophil granule lumen
  The volume enclosed by the membrane of an azurophil granule, a primary lysosomal granule found in neutrophil granulocytes that contains a wide range of hydrolytic enzymes and is released into the extracellular fluid.
• GO:0035580 Specific granule lumen
  The volume enclosed by the membrane of a specific granule, a granule with a membranous, tubular internal structure, found primarily in mature neutrophil cells. Most are released into the extracellular fluid. Specific granules contain lactoferrin, lysozyme, vitamin B12 binding protein and elastase.
• GO:0070062 Extracellular exosome
  A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.

Molecular function (2)

• GO:0004715 Non-membrane spanning protein tyrosine kinase activity
  Catalysis of the reaction: ATP + protein L-tyrosine = ADP + protein L-tyrosine phosphate by a non-membrane spanning protein.
• GO:0005515 Protein binding
  Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).

Biological process (4)

• GO:0000122 Negative regulation of transcription from RNA polymerase II promoter
  Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
• GO:0006468 Protein phosphorylation
  The process of introducing a phosphate group on to a protein.
• GO:0008285 Negative regulation of cell proliferation
  Any process that stops, prevents or reduces the rate or extent of cell proliferation.
• GO:0043312 Neutrophil degranulation
  The regulated exocytosis of secretory granules containing preformed mediators such as proteases, lipases, and inflammatory mediators by a neutrophil.

Protein Sequence

>P42685
MSNICQRLWEYLEPYLPCLSTEADKSTVIENPGALCSPQSQRHGHYFVALFDYQARTAEDLSFRAGDKLQVLDTLHEGWW
FARHLEKRRDGSSQQLQGYIPSNYVAEDRSLQAEPWFFGAIGRSDAEKQLLYSENKTGSFLIRESESQKGEFSLSVLDGA
VVKHYRIKRLDEGGFFLTRRRIFSTLNEFVSHYTKTSDGLCVKLGKPCLKIQVPAPFDLSYKTVDQWEIDRNSIQLLKRL
GSGQFGEVWEGLWNNTTPVAVKTLKPGSMDPNDFLREAQIMKNLRHPKLIQLYAVCTLEDPIYIITELMRHGSLQEYLQN
DTGSKIHLTQQVDMAAQVASGMAYLESRNYIHRDLAARNVLVGEHNIYKVADFGLARVFKVDNEDIYESRHEIKLPVKWT
APEAIRSNKFSIKSDVWSFGILLYEIITYGKMPYSGMTGAQVIQMLAQNYRLPQPSNCPQQFYNIMLECWNAEPKERPTF
ETLRWKLEDYFETDSSYSDANNFIR