SYK Tyrosine-protein kinase SYK

• Overview
• Annotations

UniProt Data

Enzyme Annotations (1)

• EC:2.7.10.2 Non-specific protein-tyrosine kinase.
  ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.

GO Annotations

Cellular component (8)

• GO:0005634 Nucleus
  A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
• GO:0005737 Cytoplasm
  All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
• GO:0005829 Cytosol
  The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
• GO:0005829 Cytosol
  The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
• GO:0005886 Plasma membrane
  The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
• GO:0032009 Early phagosome
  A membrane-bounded intracellular vesicle as initially formed upon the ingestion of particulate material by phagocytosis.
• GO:0042101 T cell receptor complex
  A protein complex that contains a disulfide-linked heterodimer of T cell receptor (TCR) chains, which are members of the immunoglobulin superfamily, and mediates antigen recognition, ultimately resulting in T cell activation. The TCR heterodimer is associated with the CD3 complex, which consists of the nonpolymorphic polypeptides gamma, delta, epsilon, zeta, and, in some cases, eta (an RNA splice variant of zeta) or Fc epsilon chains.
• GO:0043234 Protein complex
  A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.

Molecular function (10)

• GO:0001784 Phosphotyrosine binding
  Interacting selectively and non-covalently with a phosphorylated tyrosine residue within a protein.
• GO:0004672 Protein kinase activity
  Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
• GO:0004672 Protein kinase activity
  Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
• GO:0004674 Protein serine/threonine kinase activity
  Catalysis of the reactions: ATP + protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
• GO:0004713 Protein tyrosine kinase activity
  Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
• GO:0004713 Protein tyrosine kinase activity
  Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
• GO:0004715 Non-membrane spanning protein tyrosine kinase activity
  Catalysis of the reaction: ATP + protein L-tyrosine = ADP + protein L-tyrosine phosphate by a non-membrane spanning protein.
• GO:0004715 Non-membrane spanning protein tyrosine kinase activity
  Catalysis of the reaction: ATP + protein L-tyrosine = ADP + protein L-tyrosine phosphate by a non-membrane spanning protein.
• GO:0005178 Integrin binding
  Interacting selectively and non-covalently with an integrin.
• GO:0005515 Protein binding
  Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).

Biological process (38)

• GO:0001945 Lymph vessel development
  The process whose specific outcome is the progression of a lymph vessel over time, from its formation to the mature structure.
• GO:0002223 Stimulatory C-type lectin receptor signaling pathway
  Any series of molecular signals generated as a consequence of binding to a C-type lectin receptor capable of cellular activation.
• GO:0002250 Adaptive immune response
  An immune response mediated by cells expressing specific receptors for antigen produced through a somatic diversification process, and allowing for an enhanced secondary response to subsequent exposures to the same antigen (immunological memory).
• GO:0002281 Macrophage activation involved in immune response
  A change in morphology and behavior of a macrophage resulting from exposure to a cytokine, chemokine, cellular ligand, or soluble factor, leading to the initiation or perpetuation of an immune response.
• GO:0002283 Neutrophil activation involved in immune response
  The change in morphology and behavior of a neutrophil resulting from exposure to a cytokine, chemokine, cellular ligand, or soluble factor, leading to the initiation or perpetuation of an immune response.
• GO:0002366 Leukocyte activation involved in immune response
  A change in morphology and behavior of a leukocyte resulting from exposure to a specific antigen, mitogen, cytokine, cellular ligand, or soluble factor, leading to the initiation or perpetuation of an immune response.
• GO:0002554 Serotonin secretion by platelet
  The regulated release of serotonin by a platelet or group of platelets.
• GO:0006468 Protein phosphorylation
  The process of introducing a phosphate group on to a protein.
• GO:0006468 Protein phosphorylation
  The process of introducing a phosphate group on to a protein.
• GO:0007159 Leukocyte cell-cell adhesion
  The attachment of a leukocyte to another cell via adhesion molecules.
• GO:0007229 Integrin-mediated signaling pathway
  A series of molecular signals initiated by the binding of extracellular ligand to an integrin on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
• GO:0007229 Integrin-mediated signaling pathway
  A series of molecular signals initiated by the binding of extracellular ligand to an integrin on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
• GO:0008283 Cell proliferation
  The multiplication or reproduction of cells, resulting in the expansion of a cell population.
• GO:0009887 Animal organ morphogenesis
  Morphogenesis of an animal organ. An organ is defined as a tissue or set of tissues that work together to perform a specific function or functions. Morphogenesis is the process in which anatomical structures are generated and organized. Organs are commonly observed as visibly distinct structures, but may also exist as loosely associated clusters of cells that work together to perform a specific function or functions.
• GO:0010543 Regulation of platelet activation
  Any process that modulates the rate or frequency of platelet activation. Platelet activation is a series of progressive, overlapping events triggered by exposure of the platelets to subendothelial tissue.
• GO:0010803 Regulation of tumor necrosis factor-mediated signaling pathway
  Any process that modulates the rate or extent of the tumor necrosis factor-mediated signaling pathway. The tumor necrosis factor-mediated signaling pathway is the series of molecular signals generated as a consequence of tumor necrosis factor binding to a cell surface receptor.
• GO:0030168 Platelet activation
  A series of progressive, overlapping events triggered by exposure of the platelets to subendothelial tissue. These events include shape change, adhesiveness, aggregation, and release reactions. When carried through to completion, these events lead to the formation of a stable hemostatic plug.
• GO:0030593 Neutrophil chemotaxis
  The directed movement of a neutrophil cell, the most numerous polymorphonuclear leukocyte found in the blood, in response to an external stimulus, usually an infection or wounding.
• GO:0031623 Receptor internalization
  A receptor-mediated endocytosis process that results in the movement of receptors from the plasma membrane to the inside of the cell. The process begins when cell surface receptors are monoubiquitinated following ligand-induced activation. Receptors are subsequently taken up into endocytic vesicles from where they are either targeted to the lysosome or vacuole for degradation or recycled back to the plasma membrane.
• GO:0032928 Regulation of superoxide anion generation
  Any process that modulates the frequency, rate or extent of enzymatic generation of superoxide by a cell.
• GO:0033630 Positive regulation of cell adhesion mediated by integrin
  Any process that activates or increases the frequency, rate, or extent of cell adhesion mediated by integrin.
• GO:0038095 Fc-epsilon receptor signaling pathway
  A series of molecular signals initiated by the binding of the Fc portion of immunoglobulin E (IgE) to an Fc-epsilon receptor on the surface of a signal-receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription. The Fc portion of an immunoglobulin is its C-terminal constant region.
• GO:0038096 Fc-gamma receptor signaling pathway involved in phagocytosis
  An Fc-gamma receptor signaling pathway that contributes to the endocytic engulfment of external particulate material by phagocytes.
• GO:0042742 Defense response to bacterium
  Reactions triggered in response to the presence of a bacterium that act to protect the cell or organism.
• GO:0042991 Transcription factor import into nucleus
  The directed movement of a transcription factor from the cytoplasm to the nucleus.
• GO:0043313 Regulation of neutrophil degranulation
  Any process that modulates the frequency, rate, or extent of neutrophil degranulation.
• GO:0045087 Innate immune response
  Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
• GO:0045579 Positive regulation of B cell differentiation
  Any process that activates or increases the frequency, rate or extent of B cell differentiation.
• GO:0045780 Positive regulation of bone resorption
  Any process that activates or increases the frequency, rate or extent of bone resorption.
• GO:0048514 Blood vessel morphogenesis
  The process in which the anatomical structures of blood vessels are generated and organized. The blood vessel is the vasculature carrying blood.
• GO:0050764 Regulation of phagocytosis
  Any process that modulates the frequency, rate or extent of phagocytosis, the process in which phagocytes engulf external particulate material.
• GO:0050853 B cell receptor signaling pathway
  A series of molecular signals initiated by the cross-linking of an antigen receptor on a B cell.
• GO:0051090 Regulation of sequence-specific DNA binding transcription factor activity
  Any process that modulates the frequency, rate or extent of the activity of a transcription factor, any factor involved in the initiation or regulation of transcription.
• GO:0070372 Regulation of ERK1 and ERK2 cascade
  Any process that modulates the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
• GO:0071226 Cellular response to molecule of fungal origin
  Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus by molecules of fungal origin such as chito-octamer oligosaccharide.
• GO:0071404 Cellular response to low-density lipoprotein particle stimulus
  Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a low-density lipoprotein particle stimulus.
• GO:0090237 Regulation of arachidonic acid secretion
  Any process that modulates the rate, frequency, or extent of arachidonic acid secretion, the controlled release of arachidonic acid from a cell or a tissue.
• GO:0090330 Regulation of platelet aggregation
  Any process that modulates the rate, frequency or extent of platelet aggregation. Platelet aggregation is the adhesion of one platelet to one or more other platelets via adhesion molecules.

Protein Sequence

>P43405
MASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRKAHHYTIERELNGTYAIAGGR
THASPADLCHYHSQESDGLVCLLKKPFNRPQGVQPKTGPFEDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIAT
TAHEKMPWFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQL
VEHYSYKADGLLRVLTVPCQKIGTQGNVNFGGRPQLPGSHPATWSAGGIISRIKSYSFPKPGHRKSSPAQGNRQESTVSF
NPYEPELAPWAADKGPQREALPMDTEVYESPYADPEEIRPKEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVA
VKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSM
GMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGV
LMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN