CRK Adapter molecule crk

• Overview
• Annotations

UniProt Data

Enzyme Annotations (0)

GO Annotations

Cellular component (5)

• GO:0005634 Nucleus
  A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
• GO:0005737 Cytoplasm
  All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
• GO:0005829 Cytosol
  The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
• GO:0043234 Protein complex
  A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.
• GO:0070062 Extracellular exosome
  A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.

Molecular function (9)

• GO:0001784 Phosphotyrosine binding
  Interacting selectively and non-covalently with a phosphorylated tyrosine residue within a protein.
• GO:0005070 SH3/SH2 adaptor activity
  Interacting selectively and non-covalently and simultaneously with one or more signal transduction molecules, usually acting as a scaffold to bring these molecules into close proximity either using their own SH2/SH3 domains (e.g. Grb2) or those of their target molecules (e.g. SAM68).
• GO:0005515 Protein binding
  Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
• GO:0017124 SH3 domain binding
  Interacting selectively and non-covalently with a SH3 domain (Src homology 3) of a protein, small protein modules containing approximately 50 amino acid residues found in a great variety of intracellular or membrane-associated proteins.
• GO:0042169 SH2 domain binding
  Interacting selectively and non-covalently with a SH2 domain (Src homology 2) of a protein, a protein domain of about 100 amino-acid residues and belonging to the alpha + beta domain class.
• GO:0043621 Protein self-association
  Interacting selectively and non-covalently with a domain within the same polypeptide.
• GO:0045309 Protein phosphorylated amino acid binding
  Interacting selectively and non-covalently with a phosphorylated amino acid residue within a protein.
• GO:0046875 Ephrin receptor binding
  Interacting selectively and non-covalently with an ephrin receptor.
• GO:1990782 Protein tyrosine kinase binding
  Interacting selectively and non-covalently with protein tyrosine kinase.

Biological process (17)

• GO:0000186 Activation of MAPKK activity
  The initiation of the activity of the inactive enzyme MAP kinase kinase (MAPKK).
• GO:0006357 Regulation of transcription from RNA polymerase II promoter
  Any process that modulates the frequency, rate or extent of transcription from an RNA polymerase II promoter.
• GO:0008360 Regulation of cell shape
  Any process that modulates the surface configuration of a cell.
• GO:0009966 Regulation of signal transduction
  Any process that modulates the frequency, rate or extent of signal transduction.
• GO:0030307 Positive regulation of cell growth
  Any process that activates or increases the frequency, rate, extent or direction of cell growth.
• GO:0032956 Regulation of actin cytoskeleton organization
  Any process that modulates the frequency, rate or extent of the formation, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising actin filaments and their associated proteins.
• GO:0038096 Fc-gamma receptor signaling pathway involved in phagocytosis
  An Fc-gamma receptor signaling pathway that contributes to the endocytic engulfment of external particulate material by phagocytes.
• GO:0043087 Regulation of GTPase activity
  Any process that modulates the rate of GTP hydrolysis by a GTPase.
• GO:0043393 Regulation of protein binding
  Any process that modulates the frequency, rate or extent of protein binding.
• GO:0048010 Vascular endothelial growth factor receptor signaling pathway
  Any series of molecular signals initiated by the binding of an extracellular ligand to a vascular endothelial growth factor receptor (VEGFR) located on the surface of the receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription.
• GO:0048013 Ephrin receptor signaling pathway
  The series of molecular signals generated as a consequence of an ephrin receptor binding to an ephrin.
• GO:0061045 Negative regulation of wound healing
  Any process that decreases the rate, frequency, or extent of the series of events that restore integrity to a damaged tissue, following an injury.
• GO:0061045 Negative regulation of wound healing
  Any process that decreases the rate, frequency, or extent of the series of events that restore integrity to a damaged tissue, following an injury.
• GO:0071538 SH2 domain-mediated complex assembly
  A process of protein complex assembly in which the arrangement and bonding together of the set of components that form the protein complex is mediated by an SH2 domain interaction.
• GO:1900026 Positive regulation of substrate adhesion-dependent cell spreading
  Any process that activates or increases the frequency, rate or extent of substrate adhesion-dependent cell spreading.
• GO:2000146 Negative regulation of cell motility
  Any process that stops, prevents, or reduces the frequency, rate or extent of cell motility.
• GO:2000146 Negative regulation of cell motility
  Any process that stops, prevents, or reduces the frequency, rate or extent of cell motility.

Protein Sequence

>P46108
MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSPAQPPP
GVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILR
IRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYA
RVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPDEDFS