Genome3D
Homo sapiens

CRKL Crk-like protein

UniProt Data

Accession P46109 [ UniProt ]
Name CRKL_HUMAN
Description Crk-like protein
Species Homo sapiens
Sequence Length303

Enzyme Annotations (0)

    GO Annotations

    Cellular component (3)

    • GO:0005768 Endosome
      A vacuole to which materials ingested by endocytosis are delivered.
    • GO:0005829 Cytosol
      The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    • GO:0070062 Extracellular exosome
      A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.

    Molecular function (6)

    • GO:0001784 Phosphotyrosine binding
      Interacting selectively and non-covalently with a phosphorylated tyrosine residue within a protein.
    • GO:0003723 RNA binding
      Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    • GO:0004871 Signal transducer activity
      Conveys a signal across a cell to trigger a change in cell function or state. A signal is a physical entity or change in state that is used to transfer information in order to trigger a response.
    • GO:0005070 SH3/SH2 adaptor activity
      Interacting selectively and non-covalently and simultaneously with one or more signal transduction molecules, usually acting as a scaffold to bring these molecules into close proximity either using their own SH2/SH3 domains (e.g. Grb2) or those of their target molecules (e.g. SAM68).
    • GO:0005515 Protein binding
      Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    • GO:0045296 Cadherin binding
      Interacting selectively and non-covalently with cadherin, a type I membrane protein involved in cell adhesion.

    Biological process (6)

    • GO:0000186 Activation of MAPKK activity
      The initiation of the activity of the inactive enzyme MAP kinase kinase (MAPKK).
    • GO:0007254 JNK cascade
      An intracellular protein kinase cascade containing at least a JNK (a MAPK), a JNKK (a MAPKK) and a JUN3K (a MAP3K). The cascade can also contain two additional tiers: the upstream MAP4K and the downstream MAP Kinase-activated kinase (MAPKAPK). The kinases in each tier phosphorylate and activate the kinases in the downstream tier to transmit a signal within a cell.
    • GO:0007265 Ras protein signal transduction
      A series of molecular signals within the cell that are mediated by a member of the Ras superfamily of proteins switching to a GTP-bound active state.
    • GO:0008284 Positive regulation of cell proliferation
      Any process that activates or increases the rate or extent of cell proliferation.
    • GO:0035556 Intracellular signal transduction
      The process in which a signal is passed on to downstream components within the cell, which become activated themselves to further propagate the signal and finally trigger a change in the function or state of the cell.
    • GO:1900026 Positive regulation of substrate adhesion-dependent cell spreading
      Any process that activates or increases the frequency, rate or extent of substrate adhesion-dependent cell spreading.

    Protein Sequence

    >P46109
MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSHYIINSLPNRRFKIGDQEFDH
LPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPNLPTAEDNLEYVRTLYDFPGNDAEDLPFKKGEILVIIEKPEEQW
WSARNKDGRVGMIPVPYVEKLVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFA
KAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPDENE