Genome3D
Homo sapiens

BLK Tyrosine-protein kinase Blk

UniProt Data

Accession P51451 [ UniProt ]
Name BLK_HUMAN
Description Tyrosine-protein kinase Blk
Species Homo sapiens
Sequence Length505

Enzyme Annotations (1)

  • EC:2.7.10.2 Non-specific protein-tyrosine kinase.
    ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.

GO Annotations

Cellular component (1)

None predicted

Molecular function (3)

  • GO:0004713 Protein tyrosine kinase activity
    Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
  • GO:0004715 Non-membrane spanning protein tyrosine kinase activity
    Catalysis of the reaction: ATP + protein L-tyrosine = ADP + protein L-tyrosine phosphate by a non-membrane spanning protein.
  • GO:0005515 Protein binding
    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).

Biological process (3)

  • GO:0032024 Positive regulation of insulin secretion
    Any process that activates or increases the frequency, rate or extent of the regulated release of insulin.
  • GO:0035556 Intracellular signal transduction
    The process in which a signal is passed on to downstream components within the cell, which become activated themselves to further propagate the signal and finally trigger a change in the function or state of the cell.
  • GO:0050853 B cell receptor signaling pathway
    A series of molecular signals initiated by the cross-linking of an antigen receptor on a B cell.

Protein Sequence

>P51451
MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDAPPLPPLVVFNHLTPPPPDEHLDEDKHFVVALYDYTAMNDRDLQML
KGEKLQVLKGTGDWWLARSLVTGREGYVPSNFVARVESLEMERWFFRSQGRKEAERQLLAPINKAGSFLIRESETNKGAF
SLSVKDVTTQGELIKHYKIRCLDEGGYYISPRITFPSLQALVQHYSKKGDGLCQRLTLPCVRPAPQNPWAQDEWEIPRQS
LRLVRKLGSGQFGEVWMGYYKNNMKVAIKTLKEGTMSPEAFLGEANVMKALQHERLVRLYAVVTKEPIYIVTEYMARGCL
LDFLKTDEGSRLSLPRLIDMSAQIAEGMAYIERMNSIHRDLRAANILVSEALCCKIADFGLARIIDSEYTAQEGAKFPIK
WTAPEAIHFGVFTIKADVWSFGVLLMEVVTYGRVPYPGMSNPEVIRNLERGYRMPRPDTCPPELYRGVIAECWRSRPEER
PTFEFLQSVLEDFYTATERQYELQP