BMX Cytoplasmic tyrosine-protein kinase BMX
UniProt Data
Accession | P51813 [ UniProt ] |
Name | BMX_HUMAN |
Description | Cytoplasmic tyrosine-protein kinase BMX |
Species | Homo sapiens |
Sequence Length | 675 |
Enzyme Annotations (1)
- EC:2.7.10.2 Non-specific protein-tyrosine kinase.
ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.
GO Annotations
Cellular component (4)
- GO:0005654 Nucleoplasm
That part of the nuclear content other than the chromosomes or the nucleolus. - GO:0005829 Cytosol
The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes. - GO:0005886 Plasma membrane
The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins. - GO:0032587 Ruffle membrane
The portion of the plasma membrane surrounding a ruffle.
Molecular function (5)
- GO:0004713 Protein tyrosine kinase activity
Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate. - GO:0004715 Non-membrane spanning protein tyrosine kinase activity
Catalysis of the reaction: ATP + protein L-tyrosine = ADP + protein L-tyrosine phosphate by a non-membrane spanning protein. - GO:0004715 Non-membrane spanning protein tyrosine kinase activity
Catalysis of the reaction: ATP + protein L-tyrosine = ADP + protein L-tyrosine phosphate by a non-membrane spanning protein. - GO:0004871 Signal transducer activity
Conveys a signal across a cell to trigger a change in cell function or state. A signal is a physical entity or change in state that is used to transfer information in order to trigger a response. - GO:0005515 Protein binding
Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
Biological process (6)
- GO:0006468 Protein phosphorylation
The process of introducing a phosphate group on to a protein. - GO:0006661 Phosphatidylinositol biosynthetic process
The chemical reactions and pathways resulting in the formation of phosphatidylinositol, any glycophospholipid in which the sn-glycerol 3-phosphate residue is esterified to the 1-hydroxyl group of 1D-myo-inositol. - GO:0007165 Signal transduction
The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell. - GO:0007498 Mesoderm development
The process whose specific outcome is the progression of the mesoderm over time, from its formation to the mature structure. The mesoderm is the middle germ layer that develops into muscle, bone, cartilage, blood and connective tissue. - GO:0046777 Protein autophosphorylation
The phosphorylation by a protein of one or more of its own amino acid residues (cis-autophosphorylation), or residues on an identical protein (trans-autophosphorylation). - GO:0097194 Execution phase of apoptosis
A stage of the apoptotic process that starts with the controlled breakdown of the cell through the action of effector caspases or other effector molecules (e.g. cathepsins, calpains etc.). Key steps of the execution phase are rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
Protein Sequence
>P51813 MDTKSILEELLLKRSQQKKKMSPNNYKERLFVLTKTNLSYYEYDKMKRGSRKGSIEIKKIRCVEKVNLEEQTPVERQYPF QIVYKDGLLYVYASNEESRSQWLKALQKEIRGNPHLLVKYHSGFFVDGKFLCCQQSCKAAPGCTLWEAYANLHTAVNEEK HRVPTFPDRVLKIPRAVPVLKMDAPSSSTTLAQYDNESKKNYGSQPPSSSTSLAQYDSNSKKIYGSQPNFNMQYIPREDF PDWWQVRKLKSSSSSEDVASSNQKERNVNHTTSKISWEFPESSSSEEEENLDDYDWFAGNISRSQSEQLLRQKGKEGAFM VRNSSQVGMYTVSLFSKAVNDKKGTVKHYHVHTNAENKLYLAENYCFDSIPKLIHYHQHNSAGMITRLRHPVSTKANKVP DSVSLGNGIWELKREEITLLKELGSGQFGVVQLGKWKGQYDVAVKMIKEGSMSEDEFFQEAQTMMKLSHPKLVKFYGVCS KEYPIYIVTEYISNGCLLNYLRSHGKGLEPSQLLEMCYDVCEGMAFLESHQFIHRDLAARNCLVDRDLCVKVSDFGMTRY VLDDQYVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFGILMWEVFSLGKQPYDLYDNSQVVLKVSQGHRLYRPHLASDT IYQIMYSCWHELPEKRPTFQQLLSSIEPLREKDKH