bzz1 Protein BZZ1
UniProt Data
Accession | Q09746 [ UniProt ] |
Name | BZZ1_SCHPO |
Description | Protein BZZ1 |
Species | Schizosaccharomyces pombe 972h- |
Sequence Length | 642 |
Enzyme Annotations (0)
GO Annotations
Cellular component (4)
- GO:0005737 Cytoplasm
All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures. - GO:0030479 Actin cortical patch
An endocytic patch that consists of an actin-containing structure found at the plasma membrane in cells; formed of networks of branched actin filaments that lie just beneath the plasma membrane and assemble, move, and disassemble rapidly. An example of this is the actin cortical patch found in Saccharomyces cerevisiae. - GO:0032153 Cell division site
The eventual plane of cell division (also known as cell cleavage or cytokinesis) in a dividing cell. In Eukaryotes, the cleavage apparatus, composed of septin structures and the actomyosin contractile ring, forms along this plane, and the mitotic, or meiotic, spindle is aligned perpendicular to the division plane. In bacteria, the cell division site is generally located at mid-cell and is the site at which the cytoskeletal structure, the Z-ring, assembles. - GO:0051286 Cell tip
The region at the end of the longest axis of a cylindrical or elongated cell.
Molecular function (1)
None predictedBiological process (2)
- GO:0006897 Endocytosis
A vesicle-mediated transport process in which cells take up external materials or membrane constituents by the invagination of a small region of the plasma membrane to form a new membrane-bounded vesicle. - GO:0007015 Actin filament organization
A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising actin filaments. Includes processes that control the spatial distribution of actin filaments, such as organizing filaments into meshworks, bundles, or other structures, as by cross-linking.
Protein Sequence
>Q09746 MSLETYKFSDELHDDFKVVDSWINNGAKWLEDIQLYYKERSSIEKEYAQKLASLSNKYGEKKSRKSSALSVGDTPAMSAG SLECASLTTWSKILDELTRSSKTHQKLSDDYSLDIAEKLKKLESHIEALRKVYDDLYKKFSSEKETLLNSVKRAKVSYHE ACDDLESARQKNDKYREQKTQRNLKLSESDMLDKKNKYLLRMLVYNAHKQKFYNETLPTLLNHMQVLNEYRVSNLNEIWC NSFSIEKSLHDTLSQRTVEIQSEIAKNEPVLDSAMFGRHNSKNWALPADLHFEPSPIWHDTDALVVDGSCKNYLRNLLVH SKNDLGKQKGELVSLDSQLEGLRVDDPNSANQSFESKKASINLEGKELMVKARIEDLEVRINKITSVANNLEEGGRFHDF KHVSFKLPTSCSYCREIIWGLSKRGCVCKNCGFKCHARCELLVPANCKNGEPEVADDDAVDTSVTATDDFDASASSSNAY ESYRNTYTDDMDSSSIYQTSLSNVKTEETTPAEPASKVDGVVLYDFTGEHEGVITASEGQEFTLLEPDDGSGWVRVKIDG TDGLIPASYVKLNDELNTSVTLDGDSSYVKALYAYTAQSDMELSIQEGDIIQVTNRNAGNGWSEGILNGVTGQFPANYVT DV