Genome3D
Homo sapiens

SRMS Tyrosine-protein kinase Srms

UniProt Data

Accession Q9H3Y6 [ UniProt ]
Name SRMS_HUMAN
Description Tyrosine-protein kinase Srms
Species Homo sapiens
Sequence Length488

Enzyme Annotations (1)

  • EC:2.7.10.2 Non-specific protein-tyrosine kinase.
    ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.

GO Annotations

Cellular component (2)

  • GO:0005737 Cytoplasm
    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
  • GO:0005829 Cytosol
    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Molecular function (3)

  • GO:0004713 Protein tyrosine kinase activity
    Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
  • GO:0004713 Protein tyrosine kinase activity
    Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
  • GO:0005515 Protein binding
    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).

Biological process (2)

  • GO:0009968 Negative regulation of signal transduction
    Any process that stops, prevents, or reduces the frequency, rate or extent of signal transduction.
  • GO:0038083 Peptidyl-tyrosine autophosphorylation
    The phosphorylation by a protein of one or more of its own tyrosine amino acid residues, or a tyrosine residue on an identical protein.

Protein Sequence

>Q9H3Y6
MEPFLRRRLAFLSFFWDKIWPAGGEPDHGTPGSLDPNTDPVPTLPAEPCSPFPQLFLALYDFTARCGGELSVRRGDRLCA
LEEGGGYIFARRLSGQPSAGLVPITHVAKASPETLSDQPWYFSGVSRTQAQQLLLSPPNEPGAFLIRPSESSLGGYSLSV
RAQAKVCHYRVSMAADGSLYLQKGRLFPGLEELLTYYKANWKLIQNPLLQPCMPQKAPRQDVWERPHSEFALGRKLGEGY
FGEVWEGLWLGSLPVAIKVIKSANMKLTDLAKEIQTLKGLRHERLIRLHAVCSGGEPVYIVTELMRKGNLQAFLGTPEGR
ALRLPPLLGFACQVAEGMSYLEEQRVVHRDLAARNVLVDDGLACKVADFGLARLLKDDIYSPSSSSKIPVKWTAPEAANY
RVFSQKSDVWSFGVLLHEVFTYGQCPYEGMTNHETLQQIMRGYRLPRPAACPAEVYVLMLECWRSSPEERPSFATLREKL
HAIHRCHP