VAV3 Guanine nucleotide exchange factor VAV3

• Overview
• Annotations

UniProt Data

Enzyme Annotations (0)

GO Annotations

Cellular component (2)

• GO:0005829 Cytosol
  The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
• GO:0070062 Extracellular exosome
  A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.

Molecular function (6)

• GO:0005070 SH3/SH2 adaptor activity
  Interacting selectively and non-covalently and simultaneously with one or more signal transduction molecules, usually acting as a scaffold to bring these molecules into close proximity either using their own SH2/SH3 domains (e.g. Grb2) or those of their target molecules (e.g. SAM68).
• GO:0005085 Guanyl-nucleotide exchange factor activity
  Stimulates the exchange of guanyl nucleotides associated with a GTPase. Under normal cellular physiological conditions, the concentration of GTP is higher than that of GDP, favoring the replacement of GDP by GTP in association with the GTPase.
• GO:0005085 Guanyl-nucleotide exchange factor activity
  Stimulates the exchange of guanyl nucleotides associated with a GTPase. Under normal cellular physiological conditions, the concentration of GTP is higher than that of GDP, favoring the replacement of GDP by GTP in association with the GTPase.
• GO:0005089 Rho guanyl-nucleotide exchange factor activity
  Stimulates the exchange of guanyl nucleotides associated with a GTPase of the Rho family. Under normal cellular physiological conditions, the concentration of GTP is higher than that of GDP, favoring the replacement of GDP by GTP in association with the GTPase.
• GO:0005096 GTPase activator activity
  Binds to and increases the activity of a GTPase, an enzyme that catalyzes the hydrolysis of GTP.
• GO:0005515 Protein binding
  Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).

Biological process (14)

• GO:0006974 Cellular response to DNA damage stimulus
  Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
• GO:0007264 Small GTPase mediated signal transduction
  Any series of molecular signals in which a small monomeric GTPase relays one or more of the signals.
• GO:0008361 Regulation of cell size
  Any process that modulates the size of a cell.
• GO:0030168 Platelet activation
  A series of progressive, overlapping events triggered by exposure of the platelets to subendothelial tissue. These events include shape change, adhesiveness, aggregation, and release reactions. When carried through to completion, these events lead to the formation of a stable hemostatic plug.
• GO:0030890 Positive regulation of B cell proliferation
  Any process that activates or increases the rate or extent of B cell proliferation.
• GO:0038095 Fc-epsilon receptor signaling pathway
  A series of molecular signals initiated by the binding of the Fc portion of immunoglobulin E (IgE) to an Fc-epsilon receptor on the surface of a signal-receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription. The Fc portion of an immunoglobulin is its C-terminal constant region.
• GO:0038096 Fc-gamma receptor signaling pathway involved in phagocytosis
  An Fc-gamma receptor signaling pathway that contributes to the endocytic engulfment of external particulate material by phagocytes.
• GO:0042493 Response to drug
  Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
• GO:0043065 Positive regulation of apoptotic process
  Any process that activates or increases the frequency, rate or extent of cell death by apoptotic process.
• GO:0043087 Regulation of GTPase activity
  Any process that modulates the rate of GTP hydrolysis by a GTPase.
• GO:0048010 Vascular endothelial growth factor receptor signaling pathway
  Any series of molecular signals initiated by the binding of an extracellular ligand to a vascular endothelial growth factor receptor (VEGFR) located on the surface of the receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription.
• GO:0048013 Ephrin receptor signaling pathway
  The series of molecular signals generated as a consequence of an ephrin receptor binding to an ephrin.
• GO:0050853 B cell receptor signaling pathway
  A series of molecular signals initiated by the cross-linking of an antigen receptor on a B cell.
• GO:0051056 Regulation of small GTPase mediated signal transduction
  Any process that modulates the frequency, rate or extent of small GTPase mediated signal transduction.

Protein Sequence

>Q9UKW4
MEPWKQCAQWLIHCKVLPTNHRVTWDSAQVFDLAQTLRDGVLLCQLLNNLRAHSINLKEINLRPQMSQFLCLKNIRTFLT
ACCETFGMRKSELFEAFDLFDVRDFGKVIETLSRLSRTPIALATGIRPFPTEESINDEDIYKGLPDLIDETLVEDEEDLY
DCVYGEDEGGEVYEDLMKAEEAHQPKCPENDIRSCCLAEIKQTEEKYTETLESIEKYFMAPLKRFLTAAEFDSVFINIPE
LVKLHRNLMQEIHDSIVNKNDQNLYQVFINYKERLVIYGQYCSGVESAISSLDYISKTKEDVKLKLEECSKRANNGKFTL
RDLLVVPMQRVLKYHLLLQELVKHTTDPTEKANLKLALDAMKDLAQYVNEVKRDNETLREIKQFQLSIENLNQPVLLFGR
PQGDGEIRITTLDKHTKQERHIFLFDLAVIVCKRKGDNYEMKEIIDLQQYKIANNPTTDKENKKWSYGFYLIHTQGQNGL
EFYCKTKDLKKKWLEQFEMALSNIRPDYADSNFHDFKMHTFTRVTSCKVCQMLLRGTFYQGYLCFKCGARAHKECLGRVD
NCGRVNSGEQGTLKLPEKRTNGLRRTPKQVDPGLPKMQVIRNYSGTPPPALHEGPPLQLQAGDTVELLKGDAHSLFWQGR
NLASGEVGFFPSDAVKPCPCVPKPVDYSCQPWYAGAMERLQAETELINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIK
ILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPEHSAGQRGNRAGNSLLSPKVLGIAIARYDFC
ARDMRELSLLKGDVVKIYTKMSANGWWRGEVNGRVGWFPSTYVEEDE