Genome3D
Schizosaccharomyces pombe 972h-

skb5 Shk1 kinase-binding protein 5

UniProt Data

Accession Q9US59 [ UniProt ]
Name SKB5_SCHPO
Description Shk1 kinase-binding protein 5
Species Schizosaccharomyces pombe 972h-
Sequence Length140

Enzyme Annotations (0)

    GO Annotations

    Cellular component (1)

    None predicted

    Molecular function (3)

    • GO:0005515 Protein binding
      Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    • GO:0019901 Protein kinase binding
      Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
    • GO:0030295 Protein kinase activator activity
      Binds to and increases the activity of a protein kinase, an enzyme which phosphorylates a protein.

    Biological process (1)

    None predicted

    Protein Sequence

    >Q9US59
MAEETEEDYLVVGRDYLYPPDHELHYGFHARVIEEEEERFVDDTFDETIEGSDDSESIDDTEVFYDAEESESTHPSASFN
VLADAVALYDFEPLHDNELGFTTGQRLCILSESSDGWLIAYDDASGRSGLVPETFVKLEV